UniProt ID | RAP2C_HUMAN | |
---|---|---|
UniProt AC | Q9Y3L5 | |
Protein Name | Ras-related protein Rap-2c | |
Gene Name | RAP2C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 183 | |
Subcellular Localization |
Cytoplasm . Recycling endosome membrane Lipid-anchor Cytoplasmic side. |
|
Protein Description | Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May play a role in SRE-mediated gene transcription.. | |
Protein Sequence | MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MREYKVVVLGS ----CCEEEEEEECC | 9.94 | - | |
5 | Ubiquitination | ---MREYKVVVLGSG ---CCEEEEEEECCC | 24.65 | 21890473 | |
11 | Phosphorylation | YKVVVLGSGGVGKSA EEEEEECCCCCCCCC | 28.36 | 20068231 | |
17 | Phosphorylation | GSGGVGKSALTVQFV CCCCCCCCCEEEEEE | 23.68 | 20068231 | |
20 | Phosphorylation | GVGKSALTVQFVTGT CCCCCCEEEEEEEEC | 16.39 | 20068231 | |
25 | Phosphorylation | ALTVQFVTGTFIEKY CEEEEEEEECHHHHC | 31.62 | 20068231 | |
27 | Phosphorylation | TVQFVTGTFIEKYDP EEEEEEECHHHHCCC | 16.45 | 20068231 | |
31 | Ubiquitination | VTGTFIEKYDPTIED EEECHHHHCCCCHHH | 50.57 | - | |
40 | Phosphorylation | DPTIEDFYRKEIEVD CCCHHHHHHCCCCCC | 32.85 | - | |
42 | Ubiquitination | TIEDFYRKEIEVDSS CHHHHHHCCCCCCCC | 52.22 | - | |
48 | Phosphorylation | RKEIEVDSSPSVLEI HCCCCCCCCHHHHHH | 49.69 | 28060719 | |
49 | Phosphorylation | KEIEVDSSPSVLEIL CCCCCCCCHHHHHHH | 19.41 | 20068231 | |
51 | Phosphorylation | IEVDSSPSVLEILDT CCCCCCHHHHHHHHC | 41.08 | 20068231 | |
58 | Phosphorylation | SVLEILDTAGTEQFA HHHHHHHCCCCHHHH | 24.44 | 28060719 | |
61 | Phosphorylation | EILDTAGTEQFASMR HHHHCCCCHHHHHHH | 24.93 | 30108239 | |
66 | Phosphorylation | AGTEQFASMRDLYIK CCCHHHHHHHHEEEE | 18.68 | 30108239 | |
71 | Phosphorylation | FASMRDLYIKNGQGF HHHHHHEEEECCCEE | 17.71 | 28270605 | |
106 | Phosphorylation | QIVRVKRYEKVPLIL HEEEEEECCCCCEEE | 17.87 | 24248375 | |
108 | Ubiquitination | VRVKRYEKVPLILVG EEEEECCCCCEEEEC | 39.97 | 21890473 | |
117 | Ubiquitination | PLILVGNKVDLEPER CEEEECCCCCCCHHH | 31.06 | - | |
127 | Sulfoxidation | LEPEREVMSSEGRAL CCHHHHHHCHHHHHH | 2.90 | 21406390 | |
140 | S-palmitoylation | ALAQEWGCPFMETSA HHHHHHCCCCHHCCC | 2.16 | 19801377 | |
148 | Ubiquitination | PFMETSAKSKSMVDE CCHHCCCCCHHHHHH | 59.17 | - | |
149 | Phosphorylation | FMETSAKSKSMVDEL CHHCCCCCHHHHHHH | 29.67 | 24719451 | |
151 | Phosphorylation | ETSAKSKSMVDELFA HCCCCCHHHHHHHHH | 31.00 | 28348404 | |
166 | Phosphorylation | EIVRQMNYSSLPEKQ HHHHHCCCCCCCHHH | 8.36 | 25884760 | |
167 | Phosphorylation | IVRQMNYSSLPEKQD HHHHCCCCCCCHHHC | 22.01 | 28442448 | |
168 | Phosphorylation | VRQMNYSSLPEKQDQ HHHCCCCCCCHHHCC | 37.27 | 28442448 | |
176 | S-palmitoylation | LPEKQDQCCTTCVVQ CCHHHCCCCCEEEEC | 2.75 | 19061864 | |
177 | S-palmitoylation | PEKQDQCCTTCVVQ- CHHHCCCCCEEEEC- | 2.68 | 19061864 | |
180 | Methylation | QDQCCTTCVVQ---- HCCCCCEEEEC---- | 1.20 | - | |
180 | Geranylgeranylation | QDQCCTTCVVQ---- HCCCCCEEEEC---- | 1.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RAP2C_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RAP2C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RAP2C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TCPZ_HUMAN | CCT6A | physical | 26344197 | |
DX39A_HUMAN | DDX39A | physical | 26344197 | |
RAB1A_HUMAN | RAB1A | physical | 26344197 | |
RAB1B_HUMAN | RAB1B | physical | 26344197 | |
RS10_HUMAN | RPS10 | physical | 26344197 | |
M4K4_HUMAN | MAP4K4 | physical | 28514442 | |
GDS1_HUMAN | RAP1GDS1 | physical | 28514442 | |
TCPB_HUMAN | CCT2 | physical | 28514442 | |
TCPG_HUMAN | CCT3 | physical | 28514442 | |
TCPD_HUMAN | CCT4 | physical | 28514442 | |
TCPA_HUMAN | TCP1 | physical | 28514442 | |
TCPZ_HUMAN | CCT6A | physical | 28514442 | |
TCPH_HUMAN | CCT7 | physical | 28514442 | |
TCPW_HUMAN | CCT6B | physical | 28514442 | |
PHLP_HUMAN | PDCL | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...