RAC1_CAEEL - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RAC1_CAEEL
• UniProt AC: Q03206
• Protein Name: Ras-related protein ced-10
• Gene Name: ced-10
• Organism: Caenorhabditis elegans.
• Sequence Length: 191
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side . Co-localizes with pak-1 and cdc-42 at hypodermal cell boundaries during embryo elongation.
• Protein Description: Required in engulfing to control the phagocytosis of apoptotic cell corpses. [PubMed: 10707082]
• Protein Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPINLGLWDTAGQEDYDRLRPLSYPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTVERLRERRLQPVSQTQGYVMAKEIKAVKYLECSALTQRGLKQVFDEAIRAVLTPPQRAKKSKCTVL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
188	Methylation	QRAKKSKCTVL---- HHHCCCCCEEC----	4.03	-
188	Geranylgeranylation	QRAKKSKCTVL---- HHHCCCCCEEC----	4.03	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RAC1_CAEEL !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RAC1_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RAC1_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MED12_CAEEL	dpy-22	genetic	16845399
TIP60_CAEEL	mys-1	genetic	16845399
CDK12_CAEEL	cdtl-7	genetic	16845399
HMG12_CAEEL	hmg-1.2	genetic	16845399
SEM5_CAEEL	sem-5	genetic	16845399
CDC42_CAEEL	cdc-42	genetic	16845399
JMJD6_CAEEL	psr-1	genetic	14645848

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.