UniProt ID | TIP60_CAEEL | |
---|---|---|
UniProt AC | Q9TYU5 | |
Protein Name | Histone acetyltransferase Tip60 homolog | |
Gene Name | mys-1 | |
Organism | Caenorhabditis elegans. | |
Sequence Length | 458 | |
Subcellular Localization | Nucleus. | |
Protein Description | Probable catalytic subunit of the Tip60 chromatin-remodeling complex. May acetylate nucleosomal histone H4 and H2A. [PubMed: 15068795 Acts in the determination of vulval and distal tip cell (DTC) precursor cell fates] | |
Protein Sequence | MTEPKKEIIEDENHGISKKIPTDPRQYEKVTEGCRLLVMMASQEEERWAEVISRCRAANGSIKFYVHYIDCNRRLDEWVQSDRLNLASCELPKKGGKKGAHLREENRDSNENEGKKSGRKRKIPLLPMDDLKAESVDPLQAISTMTSGSTPSLRGSMSMVGHSEDAMTRIRNVECIELGRSRIQPWYFAPYPQQLTSLDCIYICEFCLKYLKSKTCLKRHMEKCAMCHPPGNQIYSHDKLSFFEIDGRKNKSYAQNLCLLAKLFLDHKTLYYDTDPFLFYVLTEEDEKGHHIVGYFSKEKESAEEYNVACILVLPPFQKKGYGSLLIEFSYELSKIEQKTGSPEKPLSDLGLLSYRSYWSMAIMKELFAFKRRHPGEDITVQDISQSTSIKREDVVSTLQQLDLYKYYKGSYIIVISDEKRQVYEKRIEAAKKKTRINPAALQWRPKEYGKKRAQIMF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
268 | Acetylation | AKLFLDHKTLYYDTD HHHHHCCCCEECCCC | 39.63 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIP60_CAEEL !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIP60_CAEEL !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIP60_CAEEL !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TIP60_CAEEL !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...