dbPTM

CDC42_CAEEL - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CDC42_CAEEL
UniProt AC	Q05062
Protein Name	Cell division control protein 42 homolog
Gene Name	cdc-42
Organism	Caenorhabditis elegans.
Sequence Length	191
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side . Recycling endosome . Co-localizes with ced-10/rac-1 and pak-1 at hypodermal cell boundaries during embryo elongation (PubMed:8824291). Localizes in punctate cytoplasmic structures along the length of
Protein Description	Plays an essential role in spindle orientation and organizing cellular and embryonic polarity by controlling the localization and activity of PAR (partitioning-defective) proteins. Required for maintaining the asymmetric cortical localization of the anterior complex proteins par-3 and par-6, the posterior cortical protein par-2, and pkc-3. [PubMed: 11412996]
Protein Sequence	MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVAPASFENVREKWVPEISHHCSKTPFLLVGTQVDLRDDPGMLEKLAKNKQKPVSTDVGEKLAKELKAVKYVECSALTQKGLKNVFDEAILAALDPPQQEKKKKCNIL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
188	Methylation	QQEKKKKCNIL---- HHHHHHHCCCC----	5.41	-
188	Geranylgeranylation	QQEKKKKCNIL---- HHHHHHHCCCC----	5.41	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CDC42_CAEEL !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CDC42_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CDC42_CAEEL !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CDC42_CAEEL !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CDC42_CAEEL

Related Literatures of Post-Translational Modification