PYL8_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PYL8_ARATH
• UniProt AC: Q9FGM1
• Protein Name: Abscisic acid receptor PYL8
• Gene Name: PYL8
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 188
• Subcellular Localization: Cytoplasm . Nucleus . Cell membrane . Localizes at the plasma membrane in the presence of a CAR protein (e.g. CAR1 and CAR4).
• Protein Description: Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition. Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs) in an ABA-independent manner but more efficiently when activated by ABA. Confers enhanced sensitivity to ABA. [PubMed: 19407143]
• Protein Sequence: MEANGIENLTNPNQEREFIRRHHKHELVDNQCSSTLVKHINAPVHIVWSLVRRFDQPQKYKPFISRCVVKGNMEIGTVREVDVKSGLPATRSTERLELLDDNEHILSIRIVGGDHRLKNYSSIISLHPETIEGRIGTLVIESFVVDVPEGNTKDETCYFVEALIKCNLKSLADISERLAVQDTTESRV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
77	Phosphorylation	KGNMEIGTVREVDVK ECCEEEEEEEEEECC	23.27	29928509

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
77	T	Phosphorylation	Kinase	CARK1	Q9LUT0	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PYL8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PYL8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
P2C03_ARATH	HAI2	physical	22829320
P2C24_ARATH	HAI3	physical	22829320
P2C16_ARATH	HAB1	physical	22829320
P2C16_ARATH	HAB1	physical	23370718
P2C07_ARATH	HAB2	physical	23370718
P2C56_ARATH	ABI1	physical	23370718
P2C77_ARATH	ABI2	physical	23370718
P2C37_ARATH	PP2CA	physical	23370718
PYL13_ARATH	PYL13	physical	24189045
P2C78_ARATH	HAI1	physical	24823379
P2C16_ARATH	HAB1	physical	19407142
P2C16_ARATH	HAB1	physical	25465408
MYB44_ARATH	MYBR1	physical	24894996

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.