| UniProt ID | PYL13_ARATH | |
|---|---|---|
| UniProt AC | Q9SN51 | |
| Protein Name | Abscisic acid receptor PYL13 | |
| Gene Name | PYL13 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 164 | |
| Subcellular Localization | Cytoplasm . Nucleus . Cell membrane . Localizes at the plasma membrane in the presence of a CAR protein. | |
| Protein Description | Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition (By similarity). Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs), selectively PP2CA, in an ABA-independent manner. [PubMed: 24165892] | |
| Protein Sequence | MESSKQKRCRSSVVETIEAPLPLVWSILRSFDKPQAYQRFVKSCTMRSGGGGGKGGEGKGSVRDVTLVSGFPADFSTERLEELDDESHVMVVSIIGGNHRLVNYKSKTKVVASPEDMAKKTVVVESYVVDVPEGTSEEDTIFFVDNIIRYNLTSLAKLTKKMMK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PYL13_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PYL13_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PYL13_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PYL13_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| P2C56_ARATH | ABI1 | physical | 24165892 | |
| P2C16_ARATH | HAB1 | physical | 24165892 | |
| P2C07_ARATH | HAB2 | physical | 24165892 | |
| P2C37_ARATH | PP2CA | physical | 24165892 | |
| P2C56_ARATH | ABI1 | physical | 24189045 | |
| P2C77_ARATH | ABI2 | physical | 24189045 | |
| P2C16_ARATH | HAB1 | physical | 24189045 | |
| P2C37_ARATH | PP2CA | physical | 24189045 | |
| P2C78_ARATH | HAI1 | physical | 24189045 | |
| P2C03_ARATH | HAI2 | physical | 24189045 | |
| P2C75_ARATH | AHG1 | physical | 24189045 | |
| PYL13_ARATH | PYL13 | physical | 24189045 | |
| PYL1_ARATH | PYL1 | physical | 24189045 | |
| PYL2_ARATH | PYL2 | physical | 24189045 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
