| UniProt ID | P2C03_ARATH | |
|---|---|---|
| UniProt AC | Q9LNW3 | |
| Protein Name | Protein phosphatase 2C 3 | |
| Gene Name | AIP1 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 442 | |
| Subcellular Localization | Cell membrane . Probably associated to the plasma membrane when interacting with AKT1 and CIPK23. | |
| Protein Description | Involved in the negative regulation of the K(+) potassium channel AKT1 by its dephosphorylation, antagonistically to CIPK proteins (e.g. CIPK23).. | |
| Protein Sequence | MADICYEDETSACESRPLWSSRKWRIGVQRFRMSPSEMNPTASTTEEEDKSEGIYNKRNKQEEYDFMNCASSSPSQSSPEEESVSLEDSDVSISDGNSSVNDVAVIPSKKTVKETDLRPRYGVASVCGRRRDMEDAVALHPSFVRKQTEFSRTRWHYFGVYDGHGCSHVAARCKERLHELVQEEALSDKKEEWKKMMERSFTRMDKEVVRWGETVMSANCRCELQTPDCDAVGSTAVVSVITPEKIIVANCGDSRAVLCRNGKAVPLSTDHKPDRPDELDRIQEAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILATDGLWDVVTNEAACTMVRMCLNRKSGRGRRRGETQTPGRRSEEEGKEEEEKVVGSRKNGKRGEITDKACTEASVLLTKLALAKHSSDNVSVVVIDLRRRRKRHVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 34 | Phosphorylation | GVQRFRMSPSEMNPT EEEEEECCHHHCCCC | 22.48 | 19880383 | |
| 36 | Phosphorylation | QRFRMSPSEMNPTAS EEEECCHHHCCCCCC | 42.02 | 19880383 | |
| 414 | Phosphorylation | TEASVLLTKLALAKH HHHHHHHHHHHHHHC | 21.61 | 24894044 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P2C03_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P2C03_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P2C03_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CIPK6_ARATH | SIP3 | physical | 21596690 | |
| CIPKG_ARATH | CIPK16 | physical | 21596690 | |
| CIPKN_ARATH | CIPK23 | physical | 21596690 | |
| CIPKO_ARATH | SOS2 | physical | 21596690 | |
| PYL8_ARATH | RCAR3 | physical | 22404835 | |
| PYL7_ARATH | PYL7 | physical | 22404835 | |
| PYL7_ARATH | PYL7 | physical | 22829320 | |
| PYL8_ARATH | RCAR3 | physical | 22829320 | |
| PYL9_ARATH | RCAR1 | physical | 22829320 | |
| PYL5_ARATH | PYL5 | physical | 22829320 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
