UniProt ID | P2C03_ARATH | |
---|---|---|
UniProt AC | Q9LNW3 | |
Protein Name | Protein phosphatase 2C 3 | |
Gene Name | AIP1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 442 | |
Subcellular Localization | Cell membrane . Probably associated to the plasma membrane when interacting with AKT1 and CIPK23. | |
Protein Description | Involved in the negative regulation of the K(+) potassium channel AKT1 by its dephosphorylation, antagonistically to CIPK proteins (e.g. CIPK23).. | |
Protein Sequence | MADICYEDETSACESRPLWSSRKWRIGVQRFRMSPSEMNPTASTTEEEDKSEGIYNKRNKQEEYDFMNCASSSPSQSSPEEESVSLEDSDVSISDGNSSVNDVAVIPSKKTVKETDLRPRYGVASVCGRRRDMEDAVALHPSFVRKQTEFSRTRWHYFGVYDGHGCSHVAARCKERLHELVQEEALSDKKEEWKKMMERSFTRMDKEVVRWGETVMSANCRCELQTPDCDAVGSTAVVSVITPEKIIVANCGDSRAVLCRNGKAVPLSTDHKPDRPDELDRIQEAGGRVIYWDGARVLGVLAMSRAIGDNYLKPYVTSEPEVTVTDRTEEDEFLILATDGLWDVVTNEAACTMVRMCLNRKSGRGRRRGETQTPGRRSEEEGKEEEEKVVGSRKNGKRGEITDKACTEASVLLTKLALAKHSSDNVSVVVIDLRRRRKRHVA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
34 | Phosphorylation | GVQRFRMSPSEMNPT EEEEEECCHHHCCCC | 22.48 | 19880383 | |
36 | Phosphorylation | QRFRMSPSEMNPTAS EEEECCHHHCCCCCC | 42.02 | 19880383 | |
414 | Phosphorylation | TEASVLLTKLALAKH HHHHHHHHHHHHHHC | 21.61 | 24894044 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P2C03_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P2C03_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P2C03_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CIPK6_ARATH | SIP3 | physical | 21596690 | |
CIPKG_ARATH | CIPK16 | physical | 21596690 | |
CIPKN_ARATH | CIPK23 | physical | 21596690 | |
CIPKO_ARATH | SOS2 | physical | 21596690 | |
PYL8_ARATH | RCAR3 | physical | 22404835 | |
PYL7_ARATH | PYL7 | physical | 22404835 | |
PYL7_ARATH | PYL7 | physical | 22829320 | |
PYL8_ARATH | RCAR3 | physical | 22829320 | |
PYL9_ARATH | RCAR1 | physical | 22829320 | |
PYL5_ARATH | PYL5 | physical | 22829320 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...