PYL9_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PYL9_ARATH
• UniProt AC: Q84MC7
• Protein Name: Abscisic acid receptor PYL9
• Gene Name: PYL9
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 187
• Subcellular Localization: Cytoplasm . Nucleus . Cell membrane . Localizes at the plasma membrane in the presence of a CAR protein.
• Protein Description: Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition. Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs) in an ABA-independent manner but more efficiently when activated by ABA. Confers enhanced sensitivity to ABA. [PubMed: 19407143]
• Protein Sequence: MMDGVEGGTAMYGGLETVQYVRTHHQHLCRENQCTSALVKHIKAPLHLVWSLVRRFDQPQKYKPFVSRCTVIGDPEIGSLREVNVKSGLPATTSTERLELLDDEEHILGIKIIGGDHRLKNYSSILTVHPEIIEGRAGTMVIESFVVDVPQGNTKDETCYFVEALIRCNLKSLADVSERLASQDITQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PYL9_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PYL9_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PYL9_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PYL9_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
P2C03_ARATH	HAI2	physical	22829320
P2C24_ARATH	HAI3	physical	22829320
P2C16_ARATH	HAB1	physical	22829320
PYL13_ARATH	PYL13	physical	24189045
P2C16_ARATH	HAB1	physical	19407142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.