dbPTM

PPLA_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PPLA_HUMAN
UniProt AC	P26678
Protein Name	Cardiac phospholamban
Gene Name	PLN
Organism	Homo sapiens (Human).
Sequence Length	52
Subcellular Localization	Endoplasmic reticulum membrane Single-pass membrane protein . Sarcoplasmic reticulum membrane Single-pass membrane protein . Mitochondrion membrane Single-pass membrane protein . Membrane Single-pass membrane protein . Colocalizes with HAX1 a
Protein Description	Reversibly inhibits the activity of ATP2A2 in cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates the contractility of the heart muscle in response to physiological stimuli via its effects on ATP2A2. Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in the heart muscle. The degree of ATP2A2 inhibition depends on the oligomeric state of PLN. ATP2A2 inhibition is alleviated by PLN phosphorylation..
Protein Sequence	MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEKVQYLT -------CHHHHHHH	11.53	-
8	Phosphorylation	MEKVQYLTRSAIRRA CHHHHHHHHHHHHHH	20.04	26437602
10	Phosphorylation	KVQYLTRSAIRRAST HHHHHHHHHHHHHHH	23.86	22210691
16	Phosphorylation	RSAIRRASTIEMPQQ HHHHHHHHHCCCCHH	28.27	3759968
17	Phosphorylation	SAIRRASTIEMPQQA HHHHHHHHCCCCHHH	21.70	3759968
36	S-palmitoylation	QNLFINFCLILICLL HHHHHHHHHHHHHHH	1.68	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
16	S	Phosphorylation	Kinase	DMPK	Q09013	Uniprot
16	S	Phosphorylation	Kinase	PRKACA	P17612	GPS
16	S	Phosphorylation	Kinase	CAMK2D	Q13557	GPS
16	S	Phosphorylation	Kinase	PKA-FAMILY	-	GPS
16	S	Phosphorylation	Kinase	PKA	-	Uniprot
16	S	Phosphorylation	Kinase	PKA_GROUP	-	PhosphoELM
17	T	Phosphorylation	Kinase	CAMK2A	Q9UQM7	PSP
17	T	Phosphorylation	Kinase	CAMK2B	Q13554	GPS
17	T	Phosphorylation	Kinase	CAMK2D	Q13557	GPS
17	T	Phosphorylation	Kinase	CAMK2	-	Uniprot
17	T	Phosphorylation	Kinase	CCDPK	-	PhosphoELM

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
17	T	Phosphorylation		16690701
Phosphorylated at Thr-17 by CaMK2, and in response to beta-adrenergic stimulation.

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PPLA_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AT2A1_HUMAN	ATP2A1	physical	12032137
AT2A2_HUMAN	ATP2A2	physical	12032137
SARCO_HUMAN	SLN	physical	12032137
AT2A1_HUMAN	ATP2A1	physical	10551848
AT2A1_HUMAN	ATP2A1	physical	11526231
PPR3A_HUMAN	PPP1R3A	physical	9845327
AT2A2_HUMAN	ATP2A2	physical	10809745
LRAD1_HUMAN	LDLRAD1	physical	24722188
TMM79_HUMAN	TMEM79	physical	24722188
EDA_HUMAN	EDA	physical	24722188
DMPK_HUMAN	DMPK	physical	15598648

Drug and Disease Associations

Kegg Disease
H00294	Dilated cardiomyopathy (DCM)
OMIM Disease
609909	Cardiomyopathy, dilated 1P (CMD1P)
613874	Cardiomyopathy, familial hypertrophic 18 (CMH18)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PPLA_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Myotonic dystrophy protein kinase phosphorylates phospholamban andregulates calcium uptake in cardiomyocyte sarcoplasmic reticulum."; Kaliman P., Catalucci D., Lam J.T., Kondo R., Gutierrez J.C.,Reddy S., Palacin M., Zorzano A., Chien K.R., Ruiz-Lozano P.; J. Biol. Chem. 280:8016-8021(2005). Cited for: PHOSPHORYLATION AT SER-16 BY DMPK.	15598648 [Abstract]
"Ca2+-calmodulin-dependent protein kinase expression and signalling inskeletal muscle during exercise."; Rose A.J., Kiens B., Richter E.A.; J. Physiol. (Lond.) 574:889-903(2006). Cited for: PHOSPHORYLATION AT THR-17 BY CAMK2.	16690701 [Abstract]