| UniProt ID | SARCO_HUMAN | |
|---|---|---|
| UniProt AC | O00631 | |
| Protein Name | Sarcolipin | |
| Gene Name | SLN | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 31 | |
| Subcellular Localization |
Sarcoplasmic reticulum membrane Single-pass membrane protein . Endoplasmic reticulum membrane Single-pass membrane protein. |
|
| Protein Description | Reversibly inhibits the activity of ATP2A1 in sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). Modulates calcium re-uptake during muscle relaxation and plays an important role in calcium homeostasis in muscle. Required for muscle-based, non-shivering thermogenesis (By similarity).. | |
| Protein Sequence | MGINTRELFLNFTIVLITVILMWLLVRSYQY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MGINTRELFLNF ---CCCCHHHHHHHH | 24.49 | 19631655 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 5 | T | Phosphorylation | Kinase | CAMK2A | Q9UQM7 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SARCO_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SARCO_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AT2A1_HUMAN | ATP2A1 | physical | 12692302 | |
| PPLA_HUMAN | PLN | physical | 12692302 | |
| AT2A1_HUMAN | ATP2A1 | physical | 12032137 | |
| AT2A2_HUMAN | ATP2A2 | physical | 12032137 | |
| PPLA_HUMAN | PLN | physical | 12032137 | |
| TMM79_HUMAN | TMEM79 | physical | 25416956 | |
| KASH5_HUMAN | CCDC155 | physical | 25416956 | |
| SYNE4_HUMAN | SYNE4 | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
