UniProt ID | PHP14_HUMAN | |
---|---|---|
UniProt AC | Q9NRX4 | |
Protein Name | 14 kDa phosphohistidine phosphatase {ECO:0000303|PubMed:12383260} | |
Gene Name | PHPT1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Exhibits phosphohistidine phosphatase activity.. | |
Protein Sequence | MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAVADLALI ------CCCCCEEEC | 12.76 | 19413330 | |
16 | Phosphorylation | IPDVDIDSDGVFKYV CCCCEECCCCEEEEE | 36.28 | 20068231 | |
22 | Phosphorylation | DSDGVFKYVLIRVHS CCCCEEEEEEEEEEC | 6.77 | 29514088 | |
29 | Phosphorylation | YVLIRVHSAPRSGAP EEEEEEECCCCCCCC | 36.79 | 29514088 | |
33 | Phosphorylation | RVHSAPRSGAPAAES EEECCCCCCCCCHHH | 37.94 | 28985074 | |
40 | Phosphorylation | SGAPAAESKEIVRGY CCCCCHHHHHHHHCC | 30.75 | 28857561 | |
41 | 2-Hydroxyisobutyrylation | GAPAAESKEIVRGYK CCCCHHHHHHHHCCC | 42.86 | - | |
41 | Acetylation | GAPAAESKEIVRGYK CCCCHHHHHHHHCCC | 42.86 | 26822725 | |
41 | Ubiquitination | GAPAAESKEIVRGYK CCCCHHHHHHHHCCC | 42.86 | - | |
48 | 2-Hydroxyisobutyrylation | KEIVRGYKWAEYHAD HHHHHCCCHHHHHHH | 42.63 | - | |
57 | Phosphorylation | AEYHADIYDKVSGDM HHHHHHHHHHHCCCH | 15.40 | 27642862 | |
59 | Ubiquitination | YHADIYDKVSGDMQK HHHHHHHHHCCCHHH | 22.71 | 21890473 | |
59 | Ubiquitination | YHADIYDKVSGDMQK HHHHHHHHHCCCHHH | 22.71 | 21890473 | |
66 | Ubiquitination | KVSGDMQKQGCDCEC HHCCCHHHCCCCCEE | 41.86 | - | |
86 | 2-Hydroxyisobutyrylation | ISHQSQDKKIHVYGY CCCCCCCCCEEEEEE | 46.09 | - | |
91 | Phosphorylation | QDKKIHVYGYSMAYG CCCCEEEEEEEECCC | 9.00 | 28152594 | |
93 | Phosphorylation | KKIHVYGYSMAYGPA CCEEEEEEEECCCCH | 4.24 | 21082442 | |
94 | Phosphorylation | KIHVYGYSMAYGPAQ CEEEEEEEECCCCHH | 7.80 | 28152594 | |
95 | Sulfoxidation | IHVYGYSMAYGPAQH EEEEEEEECCCCHHH | 2.22 | 28465586 | |
97 | Phosphorylation | VYGYSMAYGPAQHAI EEEEEECCCCHHHCC | 18.26 | 28152594 | |
105 | Phosphorylation | GPAQHAISTEKIKAK CCHHHCCCHHHHHHH | 31.15 | 24719451 | |
106 | Phosphorylation | PAQHAISTEKIKAKY CHHHCCCHHHHHHHC | 34.87 | 24719451 | |
112 | Ubiquitination | STEKIKAKYPDYEVT CHHHHHHHCCCCEEE | 52.92 | - | |
113 | Phosphorylation | TEKIKAKYPDYEVTW HHHHHHHCCCCEEEE | 13.24 | 28152594 | |
116 | Phosphorylation | IKAKYPDYEVTWAND HHHHCCCCEEEECCC | 14.06 | 28152594 | |
119 | Phosphorylation | KYPDYEVTWANDGY- HCCCCEEEECCCCC- | 13.61 | 28152594 | |
125 | Phosphorylation | VTWANDGY------- EEECCCCC------- | 20.46 | 28152594 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHP14_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHP14_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHP14_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DNM3L_HUMAN | DNMT3L | physical | 16189514 | |
PTMS_HUMAN | PTMS | physical | 22939629 | |
PSME1_HUMAN | PSME1 | physical | 22939629 | |
RANB3_HUMAN | RANBP3 | physical | 22939629 | |
ZPR1_HUMAN | ZPR1 | physical | 22939629 | |
GDPP1_HUMAN | GDPGP1 | physical | 26344197 | |
PTPA_HUMAN | PPP2R4 | physical | 26344197 | |
TPPC4_HUMAN | TRAPPC4 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"An extensive survey of tyrosine phosphorylation revealing new sitesin human mammary epithelial cells."; Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A.,Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D.,Wiley H.S., Qian W.-J.; J. Proteome Res. 8:3852-3861(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-116 AND TYR-125, ANDMASS SPECTROMETRY. |