| UniProt ID | ONCM_HUMAN | |
|---|---|---|
| UniProt AC | P13725 | |
| Protein Name | Oncostatin-M | |
| Gene Name | OSM | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 252 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity).. | |
| Protein Sequence | MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 98 | Phosphorylation | GRRGFLQTLNATLGC CHHHHHHHHHHHHHH | 24.91 | 22817900 | |
| 100 | N-linked_Glycosylation | RGFLQTLNATLGCVL HHHHHHHHHHHHHHH | 33.98 | UniProtKB CARBOHYD | |
| 102 | Phosphorylation | FLQTLNATLGCVLHR HHHHHHHHHHHHHHH | 23.70 | 22817900 | |
| 179 | O-linked_Glycosylation | ASQPPTPTPASDAFQ CCCCCCCCCCCHHHH | 33.68 | OGP | |
| 215 | Phosphorylation | VFSKWGESPNRSRRH HHHHCCCCCCCCCCC | 24.44 | - | |
| 217 | N-linked_Glycosylation | SKWGESPNRSRRHSP HHCCCCCCCCCCCCH | 64.93 | UniProtKB CARBOHYD | |
| 219 | Phosphorylation | WGESPNRSRRHSPHQ CCCCCCCCCCCCHHH | 40.06 | - | |
| 235 | Phosphorylation | LRKGVRRTRPSRKGK HHHCHHHCCCCCCCC | 36.05 | - | |
| 238 | Phosphorylation | GVRRTRPSRKGKRLM CHHHCCCCCCCCCCC | 43.25 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ONCM_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ONCM_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ONCM_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| C1QBP_HUMAN | C1QBP | physical | 26186194 | |
| UBE2O_HUMAN | UBE2O | physical | 26186194 | |
| IL6RB_HUMAN | IL6ST | physical | 26186194 | |
| CE022_HUMAN | C5orf22 | physical | 26186194 | |
| ZN579_HUMAN | ZNF579 | physical | 26186194 | |
| TRPM3_HUMAN | TRPM3 | physical | 26186194 | |
| CO4A6_HUMAN | COL4A6 | physical | 25241761 | |
| IL6RB_HUMAN | IL6ST | physical | 28514442 | |
| CE022_HUMAN | C5orf22 | physical | 28514442 | |
| C1QBP_HUMAN | C1QBP | physical | 28514442 | |
| TRPM3_HUMAN | TRPM3 | physical | 28514442 | |
| ZN579_HUMAN | ZNF579 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
