UniProt ID | NSE3_HUMAN | |
---|---|---|
UniProt AC | Q96MG7 | |
Protein Name | Non-structural maintenance of chromosomes element 3 homolog | |
Gene Name | NSMCE3 {ECO:0000312|HGNC:HGNC:7677} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 304 | |
Subcellular Localization | Cytoplasm. Nucleus . Chromosome, telomere . | |
Protein Description | Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination. [PubMed: 20864041] | |
Protein Sequence | MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
49 | Phosphorylation | GFAEEAPSTSRGPGG CCCCCCCCCCCCCCC | 23401153 | ||
50 | Phosphorylation | FAEEAPSTSRGPGGS CCCCCCCCCCCCCCC | 22199227 | ||
51 | Phosphorylation | AEEAPSTSRGPGGSQ CCCCCCCCCCCCCCC | 30576142 | ||
57 | Phosphorylation | TSRGPGGSQGSQGPS CCCCCCCCCCCCCCC | 17525332 | ||
60 | Phosphorylation | GPGGSQGSQGPSPQG CCCCCCCCCCCCHHH | 17525332 | ||
64 | Phosphorylation | SQGSQGPSPQGARRA CCCCCCCCHHHHHHH | 29255136 | ||
83 | Ubiquitination | AVGPRSQKQLELKVS CCCCCCHHHHHHHHH | 23000965 | ||
88 | Ubiquitination | SQKQLELKVSELVQF CHHHHHHHHHHHHHH | 23000965 | ||
113 | Ubiquitination | IKRADILKHVIGDYK CCHHHHHHHHHCCHH | 22817900 | ||
120 | Ubiquitination | KHVIGDYKDIFPDLF HHHHCCHHHHCHHHH | 32015554 | ||
128 | Ubiquitination | DIFPDLFKRAAERLQ HHCHHHHHHHHHHHH | 22817900 | ||
141 | Ubiquitination | LQYVFGYKLVELEPK HHHHHCCEEEEEECC | 22817900 | ||
194 | Ubiquitination | FMKGNTIKETEAWDF HHCCCCCCHHHHHHH | 29967540 | ||
211 | Ubiquitination | RLGVYPTKKHLIFGD HHCCCCCCCEEECCC | 33845483 | ||
212 | Ubiquitination | LGVYPTKKHLIFGDP HCCCCCCCEEECCCH | 29967540 | ||
220 | Ubiquitination | HLIFGDPKKLITEDF EEECCCHHHHCCHHH | 29967540 | ||
221 | Ubiquitination | LIFGDPKKLITEDFV EECCCHHHHCCHHHH | 29967540 | ||
246 | Phosphorylation | PHTDPVDYEFQWGPR CCCCCCCCCCCCCCC | 22817900 | ||
254 | Phosphorylation | EFQWGPRTNLETSKM CCCCCCCCCCHHHHH | - | ||
260 | Acetylation | RTNLETSKMKVLKFV CCCCHHHHHHHHHHH | 7710531 | ||
265 | Ubiquitination | TSKMKVLKFVAKVHN HHHHHHHHHHHHHCC | 29967540 | ||
269 | Ubiquitination | KVLKFVAKVHNQDPK HHHHHHHHHCCCCCC | 33845483 | ||
276 | Ubiquitination | KVHNQDPKDWPAQYC HHCCCCCCCCCHHHH | 29967540 | ||
282 | Phosphorylation | PKDWPAQYCEALADE CCCCCHHHHHHHHCH | 29759185 | ||
298 | Phosphorylation | NRARPQPSGPAPSS- HHCCCCCCCCCCCC- | 29396449 | ||
303 | Phosphorylation | QPSGPAPSS------ CCCCCCCCC------ | 30266825 | ||
304 | Phosphorylation | PSGPAPSS------- CCCCCCCC------- | 30266825 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NSE3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NSE3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NSE3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
E2F1_HUMAN | E2F1 | physical | 14593116 | |
TNR16_HUMAN | NGFR | physical | 14593116 | |
NSE1_HUMAN | NSMCE1 | physical | 20864041 | |
PJA1_HUMAN | PJA1 | physical | 20864041 | |
TIF1B_HUMAN | TRIM28 | physical | 20864041 | |
NSE4A_HUMAN | NSMCE4A | physical | 20864041 | |
NSE1_HUMAN | NSMCE1 | physical | 18086888 | |
SMC6_HUMAN | SMC6 | physical | 18086888 | |
EID3_HUMAN | EID3 | physical | 21364888 | |
NSE1_HUMAN | NSMCE1 | physical | 21364888 | |
NSE4A_HUMAN | NSMCE4A | physical | 21364888 | |
SMC5_HUMAN | SMC5 | physical | 26344197 | |
SMC6_HUMAN | SMC6 | physical | 26344197 | |
NSE1_HUMAN | NSMCE1 | physical | 26910052 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...