NPM2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NPM2_HUMAN
• UniProt AC: Q86SE8
• Protein Name: Nucleoplasmin-2
• Gene Name: NPM2
• Organism: Homo sapiens (Human).
• Sequence Length: 214
• Subcellular Localization: Nucleus. Found in the oocyte nucleus before nuclear membrane breakdown, after which it is redistributed to the cytoplasm..
• Protein Description: Core histones chaperone involved in chromatin reprogramming, specially during fertilization and early embryonic development. Probably involved in sperm DNA decondensation during fertilization..
• Protein Sequence: MNLSSASSTEEKAVTTVLWGCELSQERRTWTFRPQLEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQASVLPMVSMVGVQLSPPVTFQLRAGSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQSPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAKKPGFKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MNLSSASSTEE ----CCCCCCCCCHH	20.89	22673903
5	Phosphorylation	---MNLSSASSTEEK ---CCCCCCCCCHHH	35.02	22673903
7	Phosphorylation	-MNLSSASSTEEKAV -CCCCCCCCCHHHHH	39.48	22673903
8	Phosphorylation	MNLSSASSTEEKAVT CCCCCCCCCHHHHHH	39.28	22673903
9	Phosphorylation	NLSSASSTEEKAVTT CCCCCCCCHHHHHHH	45.74	22673903
29	Phosphorylation	ELSQERRTWTFRPQL CCCCCCCEEEECHHH	34.77	28348404
86	Phosphorylation	TIASLQASVLPMVSM EHHHHHHHHHCCCEE	15.95	-
174	Phosphorylation	LVPQKQASVAKKKKL HCCHHHHHHHHHHHH	21.80	26074081
196	Phosphorylation	RASVRDKSPVKKAKA HHHHCCCCHHHHHHH	38.93	29414761
202	Acetylation	KSPVKKAKATARAKK CCHHHHHHHHHHHCC	55.97	26210075

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NPM2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NPM2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NPM2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SDCB2_HUMAN	SDCBP2	physical	25416956
PKHF2_HUMAN	PLEKHF2	physical	25416956
NPM_HUMAN	NPM1	physical	28514442
GOPC_HUMAN	GOPC	physical	28514442
C1QBP_HUMAN	C1QBP	physical	28514442
NPM3_HUMAN	NPM3	physical	28514442
MTG2_HUMAN	MTG2	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.