| UniProt ID | MTF1_YEAST | |
|---|---|---|
| UniProt AC | P14908 | |
| Protein Name | Mitochondrial transcription factor 1 | |
| Gene Name | MTF1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 341 | |
| Subcellular Localization | Mitochondrion intermembrane space . | |
| Protein Description | Mitochondrial transcription factor that confers selective promoter recognition on the core subunit of the yeast mitochondrial RNA polymerase. Interacts with DNA in a non-specific manner.. | |
| Protein Sequence | MSVPIPGIKDISKLKFFYGFKYLWNPTVYNKIFDKLDLTKTYKHPEELKVLDLYPGVGIQSAIFYNKYCPRQYSLLEKRSSLYKFLNAKFEGSPLQILKRDPYDWSTYSNLIDEERIFVPEVQSSDHINDKFLTVANVTGEGSEGLIMQWLSCIGNKNWLYRFGKVKMLLWMPSTTARKLLARPGMHSRSKCSVVREAFTDTKLIAISDANELKGFDSQCIEEWDPILFSAAEIWPTKGKPIALVEMDPIDFDFDVDNWDYVTRHLMILKRTPLNTVMDSLGHGGQQYFNSRITDKDLLKKCPIDLTNDEFIYLTKLFMEWPFKPDILMDFVDMYQTEHSG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSVPIPGIK ------CCCCCCCCC | 36.28 | 19823750 | |
| 12 | Phosphorylation | IPGIKDISKLKFFYG CCCCCCHHHCCEECC | 41.91 | 19823750 | |
| 84 | Acetylation | EKRSSLYKFLNAKFE HHHHHHHHHHHHHCC | 48.98 | 24489116 | |
| 93 | Phosphorylation | LNAKFEGSPLQILKR HHHHCCCCCCCHHCC | 18.42 | 19795423 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTF1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTF1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTF1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RPOM_YEAST | RPO41 | physical | 7929382 | |
| RPOM_YEAST | RPO41 | physical | 15342628 | |
| SNF5_YEAST | SNF5 | physical | 16554755 | |
| TFB1_YEAST | TFB1 | physical | 16554755 | |
| TOR1_YEAST | TOR1 | physical | 16554755 | |
| ECM27_YEAST | ECM27 | physical | 16554755 | |
| CAF4_YEAST | CAF4 | physical | 16554755 | |
| ERG6_YEAST | ERG6 | physical | 16554755 | |
| TF3A_YEAST | PZF1 | physical | 16554755 | |
| ATPB_YEAST | ATP2 | genetic | 27811238 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
