MSS4_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MSS4_HUMAN
• UniProt AC: P47224
• Protein Name: Guanine nucleotide exchange factor MSS4
• Gene Name: RABIF
• Organism: Homo sapiens (Human).
• Sequence Length: 123
• Protein Description: Guanine-nucleotide-releasing protein that acts on members of the SEC4/YPT1/RAB subfamily. Stimulates GDP release from both YPT1 and RAB3A, but is less active on these proteins than on the SEC4 protein. Might play a general role in vesicular transport..
• Protein Sequence: MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MEPAEQPS -------CCCCCCHH	14.54	22223895
8	Phosphorylation	MEPAEQPSELVSAEG CCCCCCHHHHHCCCC	43.17	27050516
35	Phosphorylation	SRVLQPGTALFSRRQ CCCCCCCCEEECCHH	27.20	27251275
39	Phosphorylation	QPGTALFSRRQLFLP CCCCEEECCHHCCCH	27.66	27251275
47	Phosphorylation	RRQLFLPSMRKKPAL CHHCCCHHHCCCCCC	33.11	27251275
114	Phosphorylation	LDDKNSFYVALERVS CCCCCCEEEEEEECC	5.66	27642862

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MSS4_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MSS4_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MSS4_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LTOR5_HUMAN	LAMTOR5	physical	16169070
UT14A_HUMAN	UTP14A	physical	16169070
RAB3A_HUMAN	RAB3A	physical	9013620
REL_HUMAN	REL	physical	25416956
ITF2_HUMAN	TCF4	physical	25416956
RASF5_HUMAN	RASSF5	physical	25416956
AHSA1_HUMAN	AHSA1	physical	26344197
ECM29_HUMAN	KIAA0368	physical	26344197
SYNC_HUMAN	NARS	physical	26344197
RASF5_HUMAN	RASSF5	physical	21516116
RAB10_HUMAN	RAB10	physical	28894007
RAB10_HUMAN	RAB10	genetic	28894007

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY.
PubMed: 19413330