UniProt ID | MLP3A_MOUSE | |
---|---|---|
UniProt AC | Q91VR7 | |
Protein Name | Microtubule-associated proteins 1A/1B light chain 3A | |
Gene Name | Map1lc3a | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 121 | |
Subcellular Localization |
Cytoplasm, cytoskeleton. Endomembrane system Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane Lipid-anchor. Cytoplasmic vesicle, autophagosome . LC3-II binds to the autophagic membranes.. |
|
Protein Description | Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.. | |
Protein Sequence | MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MPSDRPFKQR -----CCCCCCHHHH | 44.98 | 22324799 | |
12 | Phosphorylation | RPFKQRRSFADRCKE CCHHHHHHHHHHHHH | 27.29 | 20713600 | |
29 | Phosphorylation | QIRDQHPSKIPVIIE HHHHHCCCCCCEEEE | 40.88 | 24224561 | |
49 | Ubiquitination | KQLPVLDKTKFLVPD CCCCCCCCCCCCCCC | 49.83 | - | |
50 | Phosphorylation | QLPVLDKTKFLVPDH CCCCCCCCCCCCCCC | 27.05 | - | |
51 | Ubiquitination | LPVLDKTKFLVPDHV CCCCCCCCCCCCCCC | 42.30 | 22790023 | |
120 | Phosphatidylethanolamine amidation | YASQETFGF------ EEECCCCCC------ | 34.47 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
12 | S | Phosphorylation | Kinase | PKA | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
12 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLP3A_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MAP1A_MOUSE | Map1a | physical | 18083104 | |
MAP1B_MOUSE | Map1b | physical | 18083104 | |
SQSTM_MOUSE | Sqstm1 | physical | 18083104 | |
ATG4B_MOUSE | Atg4b | physical | 18083104 | |
ATG3_MOUSE | Atg3 | physical | 18083104 | |
WDFY3_MOUSE | Wdfy3 | physical | 18083104 | |
SQSTM_MOUSE | Sqstm1 | physical | 18524774 | |
ATG7_MOUSE | Atg7 | physical | 18083104 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...