dbPTM

ATG4B_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ATG4B_MOUSE
UniProt AC	Q8BGE6
Protein Name	Cysteine protease ATG4B
Gene Name	Atg4b
Organism	Mus musculus (Mouse).
Sequence Length	393
Subcellular Localization	Cytoplasm.
Protein Description	Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3, GABARAPL1, GABARAPL2 and GABARAP, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms (By similarity)..
Protein Sequence	MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRRNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFNVLNAFLDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRANLPCAGAAALPTDSERHCNGFPAGAEVTNRPSAWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVELTDSCFIPDESFHCQHPPSRMGIGELDPSIAVGFFCKTEEDFNDWCQQVKKLSQLGGALPMFELVEQQPSHLACQDVLNLSLDSSDVERLERFFDSEDEDFEILSL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MDAATLTY -------CCCCCCCC	7.74	-
5	Phosphorylation	---MDAATLTYDTLR ---CCCCCCCCCHHH	22.73	29514104
7	Phosphorylation	-MDAATLTYDTLRFA -CCCCCCCCCHHHHH	18.26	22817900
8	Phosphorylation	MDAATLTYDTLRFAE CCCCCCCCCHHHHHC	15.28	24224561
10	Phosphorylation	AATLTYDTLRFAEFE CCCCCCCHHHHHCCC	14.93	29514104
34	Phosphorylation	WILGRKYSIFTEKDE EECCCCEEECCCHHH	17.79	28507225
37	Phosphorylation	GRKYSIFTEKDEILS CCCEEECCCHHHHHH	40.22	29899451
74	Glutathionylation	TSDTGWGCMLRCGQM CCCCCCCHHHHHCCH	1.55	24333276
262	Phosphorylation	VIGGKPNSAHYFIGY EECCCCCCCHHEEEE	25.58	-
368	Phosphorylation	CQDVLNLSLDSSDVE HHHHHHCCCCHHHHH	29.11	26824392
371	Phosphorylation	VLNLSLDSSDVERLE HHHCCCCHHHHHHHH	33.46	26643407
372	Phosphorylation	LNLSLDSSDVERLER HHCCCCHHHHHHHHH	45.39	26643407
383	Phosphorylation	RLERFFDSEDEDFEI HHHHHHCCCCCCCEE	41.62	24925903
392	Phosphorylation	DEDFEILSL------ CCCCEEECC------	37.38	24925903

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ATG4B_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ATG4B_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ATG4B_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ATG4B_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ATG4B_MOUSE

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Large-scale phosphorylation analysis of mouse liver."; Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34, AND MASSSPECTROMETRY.	17242355 [Abstract]
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry."; Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.; J. Proteome Res. 6:250-262(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-383, AND MASSSPECTROMETRY.	17203969 [Abstract]