MEIS2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MEIS2_MOUSE
• UniProt AC: P97367
• Protein Name: Homeobox protein Meis2
• Gene Name: Meis2
• Organism: Mus musculus (Mouse).
• Sequence Length: 477
• Subcellular Localization: Nucleus . Cytoplasm, perinuclear region .
• Protein Description: Involved in transcriptional regulation. Binds to HOX or PBX proteins to form dimers, or to a DNA-bound dimer of PBX and HOX proteins and thought to have a role in stabilization of the homeoprotein-DNA complex. Isoform Meis2B is required for the activity of a PDX1:PBX1b:MEIS2b complex in pancreatic acinar cells involved in the transcriptional activation of the ELA1 enhancer; the complex binds to the enhancer B element and cooperates with the transcription factor 1 complex (PTF1) bound to the enhancer A element; MEIS2 is not involved in complex DNA-binding. Probably in complex with PBX1, is involved in transcriptional regulation by KLF4. Isoforms Meis2B and Meis2D can bind to a EPHA8 promoter sequence containing the DNA motif 5'-CGGTCA-3'; in cooperation with a PBX protein (such as PBX2) is proposed to be involved in the transcriptional activation of EPHA8 in the developing midbrain. May be involved in regulation of myeloid differentiation. Can bind to the DNA sequence 5'-TGACAG-3'in the activator ACT sequence of the D(1A) dopamine receptor (DRD1) promoter and activate DRD1 transcription..
• Protein Sequence: MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMGMAQPSYTPPQMTPHPTQLRHGPPMHSYLPSHPHHPAMVMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
195	Phosphorylation	VIDERDGSSKSDHEE EEECCCCCCCCCCCH	38.59	27681418
196	Phosphorylation	IDERDGSSKSDHEEL EECCCCCCCCCCCHH	41.53	20415495
198	Phosphorylation	ERDGSSKSDHEELSG CCCCCCCCCCCHHCC	46.26	28418008
204	Phosphorylation	KSDHEELSGSSTNLA CCCCCHHCCCCCCCC	39.65	20415495
206	Phosphorylation	DHEELSGSSTNLADH CCCHHCCCCCCCCCC	30.52	25338131
248	Phosphorylation	ASQSGDNSSEQGDGL CCCCCCCCCCCCCCC	39.74	25338131
249	Phosphorylation	SQSGDNSSEQGDGLD CCCCCCCCCCCCCCC	39.95	25338131
261	Phosphorylation	GLDNSVASPGTGDDD CCCCCCCCCCCCCCC	23.00	25338131
264	Phosphorylation	NSVASPGTGDDDDPD CCCCCCCCCCCCCCC	40.60	25338131

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MEIS2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MEIS2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MEIS2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PAX6_MOUSE	Pax6	physical	20211142
PBX1_MOUSE	Pbx1	physical	20211142
PBX2_MOUSE	Pbx2	physical	20211142
PBX3_MOUSE	Pbx3	physical	20211142
TFE2_MOUSE	Tcf3	physical	20211142
PBX4_MOUSE	Pbx4	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Solid tumor proteome and phosphoproteome analysis by high resolutionmass spectrometry.";
Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J.,Faessler R., Mann M.;
J. Proteome Res. 7:5314-5326(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-198, AND MASSSPECTROMETRY.
PubMed: 19367708