UniProt ID | KMT5A_DROME | |
---|---|---|
UniProt AC | Q9VFK6 | |
Protein Name | Histone-lysine N-methyltransferase PR-Set7 {ECO:0000303|PubMed:12086618} | |
Gene Name | PR-Set7 {ECO:0000303|PubMed:12086618, ECO:0000312|FlyBase:FBgn0011474} | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 691 | |
Subcellular Localization | Nucleus. Chromosome. Specifically localizes to mitotic chromosomes. Associates to chromatin-dense and transcriptionally silent euchromatic regions. | |
Protein Description | Histone methyltransferase that specifically monomethylates 'Lys-20' of histone H4. H4 'Lys-20' monomethylation is enriched during mitosis and represents a specific tag for epigenetic transcriptional repression. Mainly functions in euchromatin regions, thereby playing a central role in the silencing of euchromatic genes. Required for cell proliferation, possibly by contributing to the maintenance of proper higher-order structure of DNA and chromosome condensation during mitosis.. | |
Protein Sequence | MIMVRRRQRPAKEAASSSSGGASSGSGIPVDQALPLNVAGNLLEDQYFASPKRKDCRLMKVTQNGQLPEATMMAHNKDNKAGRTIGVPLATRSQTRTIENFFKANAAAKDSQKTIHTEEQLNLGNQELKLDDEELNGQIKLDDEVLKLADKQINENLPFADEVDAKAEQKLMDEELQQVVEELLFDGSSRASSNSPFYQHDMDVMQEIQQTPEIPHIKKVTEPLEGLGSLADFQTHRSALRDSHSSTHSSSTDNIFLQEPVLTLDIDRTPTKASSIKINRSFELAGAVFSSPPSVLNACLNGRFNQIVSLNGQKEALDLPHFDLDQHDSSSCDSGVACGLTANTESPAGQPRRRKPATPHRILCPSPIKTALKVTGGICKVGSADPLSPRKSPRKLPTTTAAVAACKSRRRLNQPKPQAPYQPQLQKPPSQQQQQQQDDIVVVLDDDDDEGDDEDDVRALIKAAEERENQNKAPATANSNKAGMKTMLKPAPVKSKTKSKGPTKGQPPLPLAATNGNREMTDFFPVRRSVRKTKTAVKEEWMRGLEQAVLEERCDGLQVRHFMGKGRGVVADRPFKRNEFVVEYVGDLISIGEAAEREKRYALDENAGCYMYYFKHKSQQYCIDATVDTGKLGRLINHSRAGNLMTKVVLIKQRPHLVLLAKDDIEPGEELTYDYGDRSKESLLHHPWLAF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | LEDQYFASPKRKDCR HHCCCCCCCCCCCCE | 30478224 | ||
192 | Phosphorylation | FDGSSRASSNSPFYQ CCCCCCCCCCCCCHH | 22817900 | ||
193 | Phosphorylation | DGSSRASSNSPFYQH CCCCCCCCCCCCHHH | 22817900 | ||
195 | Phosphorylation | SSRASSNSPFYQHDM CCCCCCCCCCHHHCH | 18327897 | ||
198 | Phosphorylation | ASSNSPFYQHDMDVM CCCCCCCHHHCHHHH | 22817900 | ||
249 | Phosphorylation | DSHSSTHSSSTDNIF CCCCCCCCCCCCCEE | 19429919 | ||
250 | Phosphorylation | SHSSTHSSSTDNIFL CCCCCCCCCCCCEEE | 19429919 | ||
251 | Phosphorylation | HSSTHSSSTDNIFLQ CCCCCCCCCCCEEEC | 19429919 | ||
252 | Phosphorylation | SSTHSSSTDNIFLQE CCCCCCCCCCEEECC | 19429919 | ||
281 | Phosphorylation | SSIKINRSFELAGAV HHCEECCEEEECCEE | 22817900 | ||
290 | Phosphorylation | ELAGAVFSSPPSVLN EECCEEECCCHHHHH | 22817900 | ||
341 | Phosphorylation | SGVACGLTANTESPA CCCCCCCCCCCCCCC | 22817900 | ||
344 | Phosphorylation | ACGLTANTESPAGQP CCCCCCCCCCCCCCC | 22817900 | ||
346 | Phosphorylation | GLTANTESPAGQPRR CCCCCCCCCCCCCCC | 22817900 | ||
366 | Phosphorylation | PHRILCPSPIKTALK CCEEECCCCCCHHHH | 25749252 | ||
383 | Phosphorylation | GGICKVGSADPLSPR CCEECCCCCCCCCCC | 22817900 | ||
388 | Phosphorylation | VGSADPLSPRKSPRK CCCCCCCCCCCCCCC | 25749252 | ||
392 | Phosphorylation | DPLSPRKSPRKLPTT CCCCCCCCCCCCCCH | 25749252 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KMT5A_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KMT5A_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KMT5A_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ATR_DROME | mei-41 | genetic | 17227890 | |
PCNA_DROME | PCNA | physical | 24806961 | |
PC_DROME | Pc | physical | 27002220 | |
DPOLA_DROME | DNApol-alpha180 | physical | 24806961 | |
BRC1_DROME | br | physical | 27002220 | |
BRC4_DROME | br | physical | 27002220 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...