UniProt ID | KLF15_HUMAN | |
---|---|---|
UniProt AC | Q9UIH9 | |
Protein Name | Krueppel-like factor 15 | |
Gene Name | KLF15 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 416 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcriptional regulator that binds to the GA element of the CLCNKA promoter. Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart (By similarity). Is a repressor of CTGF expression, involved in the control of cardiac fibrosis. It is also involved in the control of cardiac hypertrophy acting through the inhibition of MEF2A and GATA4 (By similarity). Involved in podocyte differentiation (By similarity). Inhibits MYOCD activity. Is a negative regulator of TP53 acetylation. Inhibits NF-kappa-B activation through repression of EP300-dependent RELA acetylation.. | |
Protein Sequence | MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
186 | Phosphorylation | KSHLHPGSSGRERCS CCCCCCCCCCCCCCC | 33.79 | - | |
187 | Phosphorylation | SHLHPGSSGRERCSP CCCCCCCCCCCCCCC | 48.02 | - | |
232 | Phosphorylation | PVPVKQESGTGPASP EEECCCCCCCCCCCC | 38.88 | 25072903 | |
234 | Phosphorylation | PVKQESGTGPASPGQ ECCCCCCCCCCCCCC | 49.63 | 25072903 | |
238 | Phosphorylation | ESGTGPASPGQAPEN CCCCCCCCCCCCCCC | 32.47 | 25072903 | |
276 | Phosphorylation | SSNLNLPSKFVRIAP CCCCCCCCCCEEEEC | 41.72 | 24719451 | |
339 | Sumoylation | YTKSSHLKAHLRRHT CCCHHHHHHHHHHHC | 28.47 | - | |
339 | Sumoylation | YTKSSHLKAHLRRHT CCCHHHHHHHHHHHC | 28.47 | - | |
339 | Ubiquitination | YTKSSHLKAHLRRHT CCCHHHHHHHHHHHC | 28.47 | - | |
346 | Phosphorylation | KAHLRRHTGEKPFAC HHHHHHHCCCCCEEE | 45.27 | 23532336 | |
397 | Phosphorylation | FARSDHLSKHIKVHR HCCCHHHHHHCEEEE | 20.83 | 27080861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLF15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLF15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLF15_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KAT2B_HUMAN | KAT2B | physical | 18586263 | |
TCF21_HUMAN | TCF21 | physical | 21988832 | |
SNX13_HUMAN | SNX13 | physical | 21988832 | |
SUV91_HUMAN | SUV39H1 | physical | 23455924 | |
EP300_HUMAN | EP300 | physical | 23999430 | |
VWA2_HUMAN | VWA2 | physical | 28514442 | |
2A5E_HUMAN | PPP2R5E | physical | 28514442 | |
ADDG_HUMAN | ADD3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...