UniProt ID | IMP3_HUMAN | |
---|---|---|
UniProt AC | Q9NV31 | |
Protein Name | U3 small nucleolar ribonucleoprotein protein IMP3 | |
Gene Name | IMP3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 184 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Component of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP). Required for the early cleavages during pre-18S ribosomal RNA processing.. | |
Protein Sequence | MVRKLKFHEQKLLKQVDFLNWEVTDHNLHELRVLRRYRLQRREDYTRYNQLSRAVRELARRLRDLPERDQFRVRASAALLDKLYALGLVPTRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLEA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Ubiquitination | KLKFHEQKLLKQVDF CCHHHHHHHHHHCCC | 53.45 | 29967540 | |
14 | Ubiquitination | FHEQKLLKQVDFLNW HHHHHHHHHCCCCCC | 59.73 | - | |
82 | Ubiquitination | ASAALLDKLYALGLV HHHHHHHHHHHCCCC | 43.28 | 23000965 | |
84 | Phosphorylation | AALLDKLYALGLVPT HHHHHHHHHCCCCCC | 12.91 | 22817900 | |
113 | Phosphorylation | FCRRRLPTVLLKLRM HHHHHHHHHHHHHHH | 28.51 | 21130716 | |
117 | Ubiquitination | RLPTVLLKLRMAQHL HHHHHHHHHHHHHHH | 29.86 | 21963094 | |
153 | Phosphorylation | PAFLVTRSMEDFVTW CHHHEECCHHHHHHH | 19.70 | 20068231 | |
159 | Phosphorylation | RSMEDFVTWVDSSKI CCHHHHHHHHCHHHH | 21.55 | 20068231 | |
163 | Phosphorylation | DFVTWVDSSKIKRHV HHHHHHCHHHHHHHH | 24.74 | 24719451 | |
164 | Phosphorylation | FVTWVDSSKIKRHVL HHHHHCHHHHHHHHH | 33.66 | 24719451 | |
165 | Acetylation | VTWVDSSKIKRHVLE HHHHCHHHHHHHHHH | 57.08 | 25953088 | |
165 | Ubiquitination | VTWVDSSKIKRHVLE HHHHCHHHHHHHHHH | 57.08 | - | |
167 | Ubiquitination | WVDSSKIKRHVLEYN HHCHHHHHHHHHHCC | 39.94 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IMP3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IMP3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IMP3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPP10_HUMAN | MPHOSPH10 | physical | 12655004 | |
CCDB1_HUMAN | CCNDBP1 | physical | 19060904 | |
USBP1_HUMAN | USHBP1 | physical | 25416956 | |
KLC3_HUMAN | KLC3 | physical | 25416956 | |
NOL10_HUMAN | NOL10 | physical | 26344197 | |
RPAB5_HUMAN | POLR2L | physical | 26344197 | |
PWP2_HUMAN | PWP2 | physical | 26344197 | |
RL17_HUMAN | RPL17 | physical | 26344197 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...