| UniProt ID | IL17_HUMAN | |
|---|---|---|
| UniProt AC | Q16552 | |
| Protein Name | Interleukin-17A | |
| Gene Name | IL17A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 155 | |
| Subcellular Localization | Secreted. | |
| Protein Description | Ligand for IL17RA and IL17RC. [PubMed: 17911633 The heterodimer formed by IL17A and IL17F is a ligand for the heterodimeric complex formed by IL17RA and IL17RC] | |
| Protein Sequence | MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Phosphorylation | AIVKAGITIPRNPGC HHHHCCCCCCCCCCC | 24.82 | 24719451 | |
| 26 | O-linked_Glycosylation | AIVKAGITIPRNPGC HHHHCCCCCCCCCCC | 24.82 | OGP | |
| 36 | Phosphorylation | RNPGCPNSEDKNFPR CCCCCCCCCCCCCCC | 32.11 | - | |
| 68 | N-linked_Glycosylation | KRSSDYYNRSTSPWN CCCCCCCCCCCCCCC | 25.79 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL17_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IL17_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL17_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| IL17_HUMAN | IL17A | physical | 9518462 | |
| CIKS_HUMAN | TRAF3IP2 | physical | 19825828 | |
| TRAF6_HUMAN | TRAF6 | physical | 19825828 | |
| AT1A3_HUMAN | ATP1A3 | physical | 26186194 | |
| DPP8_HUMAN | DPP8 | physical | 26186194 | |
| LONP2_HUMAN | LONP2 | physical | 26186194 | |
| IL2_HUMAN | IL2 | physical | 26186194 | |
| I17RA_HUMAN | IL17RA | physical | 26186194 | |
| TXD15_HUMAN | TXNDC15 | physical | 26186194 | |
| IL2_HUMAN | IL2 | physical | 28514442 | |
| DPP8_HUMAN | DPP8 | physical | 28514442 | |
| LONP2_HUMAN | LONP2 | physical | 28514442 | |
| TXD15_HUMAN | TXNDC15 | physical | 28514442 | |
| I17RA_HUMAN | IL17RA | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
