UniProt ID | ICP27_HHV8P | |
---|---|---|
UniProt AC | Q2HR75 | |
Protein Name | mRNA export factor ICP27 homolog | |
Gene Name | ORF57 | |
Organism | Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus). | |
Sequence Length | 455 | |
Subcellular Localization | Host cytoplasm. Host nucleus. Shuttles between the nucleus and the cytoplasm. | |
Protein Description | Early protein that promotes the accumulation and nuclear export of viral intronless RNA transcripts by interacting with mRNAs and cellular export proteins. Probably acts as a viral splicing factor that regulates viral RNA splicing. Functions as a multifunctional regulator of the expression of viral lytic genes.. | |
Protein Sequence | MVQAMIDMDIMKGILEDSVSSSEFDESRDDETDAPTLEDEQLSEPAEPPADERIRGTQSAQGIPPPLGRIPKKSQGRSQLRSEIQFCSPLSRPRSPSPVNRYGKKIKFGTAGQNTRPPPEKRPRRRPRDRLQYGRTTRGGQCRAAPKRATRRPQVNCQRQDDDVRQGVSDAVKKLRLPASMIIDGESPRFDDSIIPRHHGACFNVFIPAPPSHVPEVFTDRDITALIRAGGKDDELINKKISAKKIDHLHRQMLSFVTSRHNQAYWVSCRRETAAAGGLQTLGAFVEEQMTWAQTVVRHGGWFDEKDIDIILDTAIFVCNAFVTRFRLLHLSCVFDKQSELALIKQVAYLVAMGNRLVEACNLLGEVKLNFRGGLLLAFVLTIPGMQSRRSISARGQELFRTLLEYYRPGDVMGLLNVIVMEHHSLCRNSECAAATRAAMGSAKFNKGLFFYPLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of ICP27_HHV8P !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ICP27_HHV8P !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ICP27_HHV8P !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ICP27_HHV8P !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NCBP1_HUMAN | NCBP1 | physical | 18974867 | |
THOC4_HUMAN | ALYREF | physical | 18974867 | |
DX39B_HUMAN | DDX39B | physical | 18974867 | |
THOC5_HUMAN | THOC5 | physical | 18974867 | |
HPTR_HUMAN | HPR | physical | 18974867 | |
IF4A3_HUMAN | EIF4A3 | physical | 18974867 | |
SRSF3_HUMAN | SRSF3 | physical | 18974867 | |
ICP27_HHV8P | ORF57 | physical | 17609285 | |
THOC4_HUMAN | ALYREF | physical | 17609285 | |
PAP_HHV8P | ORF59 | physical | 17609285 | |
BRD4_HUMAN | BRD4 | physical | 25544563 | |
BRD2_HUMAN | BRD2 | physical | 25544563 | |
IFT81_HUMAN | IFT81 | physical | 25544563 | |
BUD23_HUMAN | WBSCR22 | physical | 25544563 | |
UBE2O_HUMAN | UBE2O | physical | 25544563 | |
GTPB1_HUMAN | GTPBP1 | physical | 25544563 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...