UniProt ID | HPTR_HUMAN | |
---|---|---|
UniProt AC | P00739 | |
Protein Name | Haptoglobin-related protein | |
Gene Name | HPR | |
Organism | Homo sapiens (Human). | |
Sequence Length | 348 | |
Subcellular Localization | Secreted . Secreted into blood plasma and associated with subtypes of high density lipoproteins (HDL). | |
Protein Description | Primate-specific plasma protein associated with apolipoprotein L-I (apoL-I)-containing high-density lipoprotein (HDL). This HDL particle, termed trypanosome lytic factor-1 (TLF-1), mediates human innate immune protection against many species of African trypanosomes. Binds hemoglobin with high affinity and may contribute to the clearance of cell-free hemoglobin to allow hepatic recycling of heme iron.. | |
Protein Sequence | MSDLGAVISLLLWGRQLFALYSGNDVTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLNDKKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYHQVDIGLIKLKQKVLVNERVMPICLPSKNYAEVGRVGYVSGWGQSDNFKLTDHLKYVMLPVADQYDCITHYEGSTCPKWKAPKSPVGVQPILNEHTFCVGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQHWVQKTIAEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSDLGAVIS ------CCHHHHHHH | 41.35 | 24043423 | |
9 | Phosphorylation | SDLGAVISLLLWGRQ CHHHHHHHHHHHHHH | 13.33 | 24043423 | |
21 | Phosphorylation | GRQLFALYSGNDVTD HHHHHHHHCCCCCCC | 15.88 | 24043423 | |
22 | Phosphorylation | RQLFALYSGNDVTDI HHHHHHHCCCCCCCC | 31.78 | 24043423 | |
27 | Phosphorylation | LYSGNDVTDISDDRF HHCCCCCCCCCCCCC | 30.40 | 24043423 | |
30 | Phosphorylation | GNDVTDISDDRFPKP CCCCCCCCCCCCCCC | 35.95 | 24043423 | |
67 | Phosphorylation | RTEGDGVYTLNDKKQ EECCCCEEECCCHHH | 15.84 | 21253578 | |
72 | Glycation | GVYTLNDKKQWINKA CEEECCCHHHHHHHH | 45.87 | - | |
112 | Acetylation | LGGHLDAKGSFPWQA HCCCCCCCCCCCCCE | 55.54 | 7666893 | |
211 | Phosphorylation | VMPICLPSKNYAEVG EECEECCCCCCEEEC | 22.15 | 24719451 | |
328 | Phosphorylation | KSCAVAEYGVYVKVT CCCEEEECEEEEEEE | 11.36 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HPTR_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HPTR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HPTR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ICP27_HHV8P | ORF57 | physical | 18974867 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...