| UniProt ID | IBP6_HUMAN | |
|---|---|---|
| UniProt AC | P24592 | |
| Protein Name | Insulin-like growth factor-binding protein 6 | |
| Gene Name | IGFBP6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 240 | |
| Subcellular Localization | Secreted. | |
| Protein Description | IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.. | |
| Protein Sequence | MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 120 | O-linked_Glycosylation | AEENPKESKPQAGTA HCCCCCCCCCCCCCC | 56.62 | 55825225 | |
| 126 | O-linked_Glycosylation | ESKPQAGTARPQDVN CCCCCCCCCCCCCCC | 23.62 | 9572875 | |
| 126 | O-linked_Glycosylation | ESKPQAGTARPQDVN CCCCCCCCCCCCCCC | 23.62 | 9572875 | |
| 143 | O-linked_Glycosylation | DQQRNPGTSTTPSQP HHHCCCCCCCCCCCC | 24.94 | OGP | |
| 144 | O-linked_Glycosylation | QQRNPGTSTTPSQPN HHCCCCCCCCCCCCC | 35.88 | - | |
| 144 | O-linked_Glycosylation | QQRNPGTSTTPSQPN HHCCCCCCCCCCCCC | 35.88 | 9572875 | |
| 145 | O-linked_Glycosylation | QRNPGTSTTPSQPNS HCCCCCCCCCCCCCC | 42.43 | 9572875 | |
| 145 | O-linked_Glycosylation | QRNPGTSTTPSQPNS HCCCCCCCCCCCCCC | 42.43 | 9572875 | |
| 146 | O-linked_Glycosylation | RNPGTSTTPSQPNSA CCCCCCCCCCCCCCC | 22.25 | 9572875 | |
| 146 | O-linked_Glycosylation | RNPGTSTTPSQPNSA CCCCCCCCCCCCCCC | 22.25 | 9572875 | |
| 148 | Phosphorylation | PGTSTTPSQPNSAGV CCCCCCCCCCCCCCC | 57.06 | 27251275 | |
| 148 | O-linked_Glycosylation | PGTSTTPSQPNSAGV CCCCCCCCCCCCCCC | 57.06 | OGP | |
| 152 | Phosphorylation | TTPSQPNSAGVQDTE CCCCCCCCCCCCCCC | 32.84 | 24505115 | |
| 152 | O-linked_Glycosylation | TTPSQPNSAGVQDTE CCCCCCCCCCCCCCC | 32.84 | - | |
| 152 | O-linked_Glycosylation | TTPSQPNSAGVQDTE CCCCCCCCCCCCCCC | 32.84 | 9572875 | |
| 176 | O-linked_Glycosylation | SVLQQLQTEVYRGAQ HHHHHHHHHHHCCCC | 35.69 | 55834601 | |
| 184 | Phosphorylation | EVYRGAQTLYVPNCD HHHCCCCEEECCCCC | 21.37 | 24732914 | |
| 184 | O-linked_Glycosylation | EVYRGAQTLYVPNCD HHHCCCCEEECCCCC | 21.37 | 55825363 | |
| 186 | Phosphorylation | YRGAQTLYVPNCDHR HCCCCEEECCCCCCC | 19.76 | 24732914 | |
| 204 | Phosphorylation | RKRQCRSSQGQRRGP CCCCCCCCCCCCCCC | 20.98 | - | |
| 204 | O-linked_Glycosylation | RKRQCRSSQGQRRGP CCCCCCCCCCCCCCC | 20.98 | 56220401 | |
| 231 | Phosphorylation | GSPDGNGSSSCPTGS CCCCCCCCCCCCCCC | 24.07 | - | |
| 233 | Phosphorylation | PDGNGSSSCPTGSSG CCCCCCCCCCCCCCC | 26.30 | 30576142 | |
| 236 | Phosphorylation | NGSSSCPTGSSG--- CCCCCCCCCCCC--- | 54.76 | 30576142 | |
| 238 | Phosphorylation | SSSCPTGSSG----- CCCCCCCCCC----- | 34.07 | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IBP6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IBP6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IBP6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TCAF2_HUMAN | FAM115C | physical | 28514442 | |
| PP2BC_HUMAN | PPP3CC | physical | 28514442 | |
| CANB1_HUMAN | PPP3R1 | physical | 28514442 | |
| CDK19_HUMAN | CDK19 | physical | 28514442 | |
| PSMG3_HUMAN | PSMG3 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| O-linked Glycosylation | |
| Reference | PubMed |
| "Enrichment of glycopeptides for glycan structure and attachment siteidentification."; Nilsson J., Rueetschi U., Halim A., Hesse C., Carlsohn E.,Brinkmalm G., Larson G.; Nat. Methods 6:809-811(2009). Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT THR-126, STRUCTURE OFCARBOHYDRATES, AND MASS SPECTROMETRY. | |
| "Identification of O-glycosylation sites and partial characterizationof carbohydrate structure and disulfide linkages of human insulin-likegrowth factor binding protein 6."; Neumann G.M., Marinaro J.A., Bach L.A.; Biochemistry 37:6572-6585(1998). Cited for: GLYCOSYLATION AT THR-126; SER-144; THR-145; THR-146 AND SER-152. | |