dbPTM

HSP22_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HSP22_DROME
UniProt AC	P02515
Protein Name	Heat shock protein 22
Gene Name	Hsp22
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	174
Subcellular Localization
Protein Description
Protein Sequence	MRSLPMFWRMAEEMARMPRLSSPFHAFFHEPPVWSVALPRNWQQIARWQEQEFAPPATVNKDGYKLTLDVKDYSELKVKVLDESVVLVEGKSEQQEAEQGGYSSRHFLRRFVLPEGYEADKVTSTLSSDGVLTISVPNPPGVQETLKEREVTIEQTGEPAKKSAEEPNDKAASQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
152	Phosphorylation	TLKEREVTIEQTGEP HHHHCEEEEEECCCC	17.65	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HSP22_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HSP22_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HSP22_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HSP27_DROME	Hsp27	physical	22036573
HSP26_DROME	Hsp26	physical	22036573
HSP23_DROME	Hsp23	physical	22036573
REF2P_DROME	ref(2)P	physical	22036573
HSP68_DROME	Hsp68	physical	22036573
TIM22_DROME	CG31229	physical	22036573
HYD_DROME	hyd	physical	22036573
EAF3_DROME	MRG15	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HSP22_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-152, AND MASSSPECTROMETRY.	17372656 [Abstract]