| UniProt ID | GSTM2_HUMAN | |
|---|---|---|
| UniProt AC | P28161 | |
| Protein Name | Glutathione S-transferase Mu 2 | |
| Gene Name | GSTM2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 218 | |
| Subcellular Localization | Cytoplasm. | |
| Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.. | |
| Protein Sequence | MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MPMTLGYWNIR ----CCCCCCCCHHH | 15.91 | 20860994 | |
| 23 | Phosphorylation | SIRLLLEYTDSSYEE HHHHHHHCCCCCHHC | 18.80 | 21082442 | |
| 24 | Phosphorylation | IRLLLEYTDSSYEEK HHHHHHCCCCCHHCC | 21.74 | 22673903 | |
| 26 | Phosphorylation | LLLEYTDSSYEEKKY HHHHCCCCCHHCCCC | 27.33 | 22673903 | |
| 27 | Phosphorylation | LLEYTDSSYEEKKYT HHHCCCCCHHCCCCC | 39.10 | 25307156 | |
| 28 | Phosphorylation | LEYTDSSYEEKKYTM HHCCCCCHHCCCCCC | 31.87 | 22673903 | |
| 31 | Ubiquitination | TDSSYEEKKYTMGDA CCCCHHCCCCCCCCC | 38.86 | 21906983 | |
| 32 | Ubiquitination | DSSYEEKKYTMGDAP CCCHHCCCCCCCCCC | 49.59 | - | |
| 33 | Phosphorylation | SSYEEKKYTMGDAPD CCHHCCCCCCCCCCC | 17.02 | 21082442 | |
| 34 | Phosphorylation | SYEEKKYTMGDAPDY CHHCCCCCCCCCCCC | 24.45 | 19060867 | |
| 41 | Phosphorylation | TMGDAPDYDRSQWLN CCCCCCCCCHHHHHH | 16.52 | 28674419 | |
| 43 | Methylation | GDAPDYDRSQWLNEK CCCCCCCHHHHHHHH | 25.23 | - | |
| 44 | Phosphorylation | DAPDYDRSQWLNEKF CCCCCCHHHHHHHHH | 23.86 | - | |
| 50 | Ubiquitination | RSQWLNEKFKLGLDF HHHHHHHHHCCCCCC | 46.88 | 21906983 | |
| 67 | Phosphorylation | LPYLIDGTHKITQSN CCEEECCCCCCCCHH | 19.09 | 22673903 | |
| 69 | Ubiquitination | YLIDGTHKITQSNAI EEECCCCCCCCHHHH | 47.49 | - | |
| 71 | Phosphorylation | IDGTHKITQSNAILR ECCCCCCCCHHHHHH | 30.65 | 20068231 | |
| 73 | Phosphorylation | GTHKITQSNAILRYI CCCCCCCHHHHHHHH | 21.41 | 28857561 | |
| 78 | Methylation | TQSNAILRYIARKHN CCHHHHHHHHHHHCC | 18.07 | - | |
| 144 | Acetylation | LYSQFLGKQPWFLGD HHHHHHCCCCCCCCC | 56.16 | 20167786 | |
| 186 | Phosphorylation | PNLKDFISRFEGLEK CCHHHHHHHHCCHHH | 30.80 | 22673903 | |
| 193 | Ubiquitination | SRFEGLEKISAYMKS HHHCCHHHHHHHHHH | 47.18 | 21906983 | |
| 199 | Ubiquitination | EKISAYMKSSRFLPR HHHHHHHHHCCCCCC | 32.38 | 21906983 | |
| 199 | Acetylation | EKISAYMKSSRFLPR HHHHHHHHHCCCCCC | 32.38 | 28734079 | |
| 200 | Phosphorylation | KISAYMKSSRFLPRP HHHHHHHHCCCCCCC | 15.37 | 20044836 | |
| 201 | Phosphorylation | ISAYMKSSRFLPRPV HHHHHHHCCCCCCCC | 22.87 | 20044836 | |
| 218 | Ubiquitination | KMAVWGNK------- EHHHCCCC------- | 58.75 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTM2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTM2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTM2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GSTM2_HUMAN | GSTM2 | physical | 12192076 | |
| GSTM1_HUMAN | GSTM1 | physical | 12192076 | |
| GSTM3_HUMAN | GSTM3 | physical | 26186194 | |
| GSTM5_HUMAN | GSTM5 | physical | 26186194 | |
| GSTM4_HUMAN | GSTM4 | physical | 26186194 | |
| GSTM5_HUMAN | GSTM5 | physical | 28514442 | |
| GSTM4_HUMAN | GSTM4 | physical | 28514442 | |
| GSTM3_HUMAN | GSTM3 | physical | 28514442 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00143 | Glutathione |
loading...