UniProt ID | GSTM2_HUMAN | |
---|---|---|
UniProt AC | P28161 | |
Protein Name | Glutathione S-transferase Mu 2 | |
Gene Name | GSTM2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 218 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.. | |
Protein Sequence | MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MPMTLGYWNIR ----CCCCCCCCHHH | 15.91 | 20860994 | |
23 | Phosphorylation | SIRLLLEYTDSSYEE HHHHHHHCCCCCHHC | 18.80 | 21082442 | |
24 | Phosphorylation | IRLLLEYTDSSYEEK HHHHHHCCCCCHHCC | 21.74 | 22673903 | |
26 | Phosphorylation | LLLEYTDSSYEEKKY HHHHCCCCCHHCCCC | 27.33 | 22673903 | |
27 | Phosphorylation | LLEYTDSSYEEKKYT HHHCCCCCHHCCCCC | 39.10 | 25307156 | |
28 | Phosphorylation | LEYTDSSYEEKKYTM HHCCCCCHHCCCCCC | 31.87 | 22673903 | |
31 | Ubiquitination | TDSSYEEKKYTMGDA CCCCHHCCCCCCCCC | 38.86 | 21906983 | |
32 | Ubiquitination | DSSYEEKKYTMGDAP CCCHHCCCCCCCCCC | 49.59 | - | |
33 | Phosphorylation | SSYEEKKYTMGDAPD CCHHCCCCCCCCCCC | 17.02 | 21082442 | |
34 | Phosphorylation | SYEEKKYTMGDAPDY CHHCCCCCCCCCCCC | 24.45 | 19060867 | |
41 | Phosphorylation | TMGDAPDYDRSQWLN CCCCCCCCCHHHHHH | 16.52 | 28674419 | |
43 | Methylation | GDAPDYDRSQWLNEK CCCCCCCHHHHHHHH | 25.23 | - | |
44 | Phosphorylation | DAPDYDRSQWLNEKF CCCCCCHHHHHHHHH | 23.86 | - | |
50 | Ubiquitination | RSQWLNEKFKLGLDF HHHHHHHHHCCCCCC | 46.88 | 21906983 | |
67 | Phosphorylation | LPYLIDGTHKITQSN CCEEECCCCCCCCHH | 19.09 | 22673903 | |
69 | Ubiquitination | YLIDGTHKITQSNAI EEECCCCCCCCHHHH | 47.49 | - | |
71 | Phosphorylation | IDGTHKITQSNAILR ECCCCCCCCHHHHHH | 30.65 | 20068231 | |
73 | Phosphorylation | GTHKITQSNAILRYI CCCCCCCHHHHHHHH | 21.41 | 28857561 | |
78 | Methylation | TQSNAILRYIARKHN CCHHHHHHHHHHHCC | 18.07 | - | |
144 | Acetylation | LYSQFLGKQPWFLGD HHHHHHCCCCCCCCC | 56.16 | 20167786 | |
186 | Phosphorylation | PNLKDFISRFEGLEK CCHHHHHHHHCCHHH | 30.80 | 22673903 | |
193 | Ubiquitination | SRFEGLEKISAYMKS HHHCCHHHHHHHHHH | 47.18 | 21906983 | |
199 | Ubiquitination | EKISAYMKSSRFLPR HHHHHHHHHCCCCCC | 32.38 | 21906983 | |
199 | Acetylation | EKISAYMKSSRFLPR HHHHHHHHHCCCCCC | 32.38 | 28734079 | |
200 | Phosphorylation | KISAYMKSSRFLPRP HHHHHHHHCCCCCCC | 15.37 | 20044836 | |
201 | Phosphorylation | ISAYMKSSRFLPRPV HHHHHHHCCCCCCCC | 22.87 | 20044836 | |
218 | Ubiquitination | KMAVWGNK------- EHHHCCCC------- | 58.75 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTM2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTM2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTM2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GSTM2_HUMAN | GSTM2 | physical | 12192076 | |
GSTM1_HUMAN | GSTM1 | physical | 12192076 | |
GSTM3_HUMAN | GSTM3 | physical | 26186194 | |
GSTM5_HUMAN | GSTM5 | physical | 26186194 | |
GSTM4_HUMAN | GSTM4 | physical | 26186194 | |
GSTM5_HUMAN | GSTM5 | physical | 28514442 | |
GSTM4_HUMAN | GSTM4 | physical | 28514442 | |
GSTM3_HUMAN | GSTM3 | physical | 28514442 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB00143 | Glutathione |
loading...