UniProt ID | GSTM1_HUMAN | |
---|---|---|
UniProt AC | P09488 | |
Protein Name | Glutathione S-transferase Mu 1 | |
Gene Name | GSTM1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 218 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.. | |
Protein Sequence | MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Phosphorylation | -MPMILGYWDIRGLA -CCCCCCEECHHHHH | 9.10 | 24043423 | |
23 | Phosphorylation | AIRLLLEYTDSSYEE HHHHHHHHCCCCHHC | 18.80 | 22817900 | |
24 | Phosphorylation | IRLLLEYTDSSYEEK HHHHHHHCCCCHHCC | 21.74 | 22673903 | |
26 | Phosphorylation | LLLEYTDSSYEEKKY HHHHHCCCCHHCCCC | 27.33 | 22673903 | |
27 | Phosphorylation | LLEYTDSSYEEKKYT HHHHCCCCHHCCCCC | 39.10 | 25307156 | |
28 | Phosphorylation | LEYTDSSYEEKKYTM HHHCCCCHHCCCCCC | 31.87 | 22673903 | |
31 (in isoform 1) | Ubiquitination | - | 38.86 | 21906983 | |
31 | Ubiquitination | TDSSYEEKKYTMGDA CCCCHHCCCCCCCCC | 38.86 | - | |
31 (in isoform 2) | Ubiquitination | - | 38.86 | 21906983 | |
32 | Ubiquitination | DSSYEEKKYTMGDAP CCCHHCCCCCCCCCC | 49.59 | - | |
33 | Phosphorylation | SSYEEKKYTMGDAPD CCHHCCCCCCCCCCC | 17.02 | 21082442 | |
34 | Phosphorylation | SYEEKKYTMGDAPDY CHHCCCCCCCCCCCC | 24.45 | 19060867 | |
35 | Sulfoxidation | YEEKKYTMGDAPDYD HHCCCCCCCCCCCCC | 4.08 | 30846556 | |
41 | Phosphorylation | TMGDAPDYDRSQWLN CCCCCCCCCHHHHHH | 16.52 | 28674419 | |
43 | Methylation | GDAPDYDRSQWLNEK CCCCCCCHHHHHHHH | 25.23 | - | |
50 (in isoform 2) | Ubiquitination | - | 46.88 | 21906983 | |
50 (in isoform 1) | Ubiquitination | - | 46.88 | 21906983 | |
50 | Ubiquitination | RSQWLNEKFKLGLDF HHHHHHHHCCCCCCC | 46.88 | 21906983 | |
52 (in isoform 2) | Ubiquitination | - | 53.35 | 21906983 | |
52 | Ubiquitination | QWLNEKFKLGLDFPN HHHHHHCCCCCCCCC | 53.35 | 21906983 | |
52 (in isoform 1) | Ubiquitination | - | 53.35 | 21906983 | |
62 | Phosphorylation | LDFPNLPYLIDGAHK CCCCCCCEEECCCHH | 21.32 | - | |
71 | Phosphorylation | IDGAHKITQSNAILC ECCCHHHHCHHHHHH | 30.65 | - | |
73 | Phosphorylation | GAHKITQSNAILCYI CCHHHHCHHHHHHHH | 21.41 | - | |
79 | Phosphorylation | QSNAILCYIARKHNL CHHHHHHHHHHHCCC | 8.31 | 25159151 | |
83 | Ubiquitination | ILCYIARKHNLCGET HHHHHHHHCCCCCCC | 28.02 | - | |
94 | Ubiquitination | CGETEEEKIRVDILE CCCCCCHHHHHHHHH | 38.81 | - | |
104 | Phosphorylation | VDILENQTMDNHMQL HHHHHCCCCCCCCCE | 37.77 | - | |
116 | Phosphorylation | MQLGMICYNPEFEKL CCEECEEECHHHHHC | 23.87 | - | |
126 | Acetylation | EFEKLKPKYLEELPE HHHHCCHHHHHHHHH | 61.96 | 19608861 | |
126 | Ubiquitination | EFEKLKPKYLEELPE HHHHCCHHHHHHHHH | 61.96 | 19608861 | |
134 | Ubiquitination | YLEELPEKLKLYSEF HHHHHHHHHHHHHHH | 49.32 | - | |
136 | Ubiquitination | EELPEKLKLYSEFLG HHHHHHHHHHHHHHC | 57.35 | - | |
144 | Ubiquitination | LYSEFLGKRPWFAGN HHHHHHCCCCCCCCC | 58.39 | - | |
144 | Acetylation | LYSEFLGKRPWFAGN HHHHHHCCCCCCCCC | 58.39 | 25953088 | |
162 (in isoform 2) | Ubiquitination | - | 27.33 | 21906983 | |
186 | Phosphorylation | PNLKDFISRFEGLEK CCHHHHHHHHCCHHH | 30.80 | 22673903 | |
193 | Ubiquitination | SRFEGLEKISAYMKS HHHCCHHHHHHHHHH | 47.18 | 21906983 | |
193 (in isoform 1) | Ubiquitination | - | 47.18 | 21906983 | |
199 | Ubiquitination | EKISAYMKSSRFLPR HHHHHHHHHCCCCCC | 32.38 | 2190698 | |
199 (in isoform 1) | Ubiquitination | - | 32.38 | 21906983 | |
199 | Acetylation | EKISAYMKSSRFLPR HHHHHHHHHCCCCCC | 32.38 | 20167786 | |
200 | Phosphorylation | KISAYMKSSRFLPRP HHHHHHHHCCCCCCC | 15.37 | - | |
201 | Phosphorylation | ISAYMKSSRFLPRPV HHHHHHHCCCCCCCC | 22.87 | - | |
210 | Phosphorylation | FLPRPVFSKMAVWGN CCCCCCCCCCCCCCC | 23.04 | - | |
211 | Ubiquitination | LPRPVFSKMAVWGNK CCCCCCCCCCCCCCC | 21.29 | - | |
218 | Ubiquitination | KMAVWGNK------- CCCCCCCC------- | 58.75 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GSTM1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GSTM1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GSTM1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
M3K5_HUMAN | MAP3K5 | physical | 12077134 | |
GSTM3_HUMAN | GSTM3 | physical | 24722188 |
loading...