dbPTM

GLIS2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GLIS2_HUMAN
UniProt AC	Q9BZE0
Protein Name	Zinc finger protein GLIS2
Gene Name	GLIS2
Organism	Homo sapiens (Human).
Sequence Length	524
Subcellular Localization	Nucleus speckle. Cytoplasm.
Protein Description	Can act either as a transcriptional repressor or as a transcriptional activator, depending on the cell context. Acts as a repressor of the Hedgehog signaling pathway (By similarity). Represses the Hedgehog-dependent expression of Wnt4 (By similarity). Necessary to maintain the differentiated epithelial phenotype in renal cells through the inhibition of SNAI1, which itself induces the epithelial-to-mesenchymal transition (By similarity). Represses transcriptional activation mediated by CTNNB1 in the Wnt signaling pathway. May act by recruiting the corepressors CTBP1 and HDAC3. May be involved in neuron differentiation (By similarity)..
Protein Sequence	MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFLLNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSGAQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSPFGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MHSLDEPLDL -----CCCCCCCHHH	35.90	29759185
13	Phosphorylation	EPLDLKLSITKLRAA CCHHHHHHHHHHHHH	26.99	29759185
15	Phosphorylation	LDLKLSITKLRAARE HHHHHHHHHHHHHHH	22.20	29759185
46	Phosphorylation	ELGLVDDSPTPGSPG HHCCCCCCCCCCCCC	26.64	27251275
48	Phosphorylation	GLVDDSPTPGSPGSP CCCCCCCCCCCCCCC	44.21	22617229
51	Phosphorylation	DDSPTPGSPGSPPSG CCCCCCCCCCCCCCC	27.56	27732954
54	Phosphorylation	PTPGSPGSPPSGFLL CCCCCCCCCCCCEEC	36.70	26657352
57	Phosphorylation	GSPGSPPSGFLLNSK CCCCCCCCCEECCCC	45.63	27251275
63	Phosphorylation	PSGFLLNSKFPEKVE CCCEECCCCCCHHCC	35.33	27251275
99	Phosphorylation	PNGSSSLSPERQGNG CCCCCCCCHHHCCCC	27.02	24719451
159	Phosphorylation	PPKDKCLSPDLPLPK CCCCCCCCCCCCCCH	26.32	22985185
245	Phosphorylation	PTCSKSFSRLENLKI CCCCCCHHHHHCCEE	42.94	21127075
251	Ubiquitination	FSRLENLKIHNRSHT HHHHHCCEEECCCCC	54.20	-
304	Phosphorylation	MPGCHKRYTDPSSLR CCCCCCCCCCHHHHH	21.94	29496907
308	Phosphorylation	HKRYTDPSSLRKHIK CCCCCCHHHHHHHHH	44.83	22798277
309	Phosphorylation	KRYTDPSSLRKHIKA CCCCCHHHHHHHHHH	37.27	24719451
419	Phosphorylation	AKNPLLPSPFGAGGL CCCCCCCCCCCCCCC	32.60	25159151
463	Phosphorylation	LGMEGHKTPLERTES HCCCCCCCCCHHCCC	27.68	27251275
491	Phosphorylation	PGTVLDLSTGVNSAA CCCEEECCCCCCCCC	23.84	22210691
499	Phosphorylation	TGVNSAASSPEALAP CCCCCCCCCCCHHCC	46.25	22210691
500	Phosphorylation	GVNSAASSPEALAPG CCCCCCCCCCHHCCC	23.25	22210691
515	Phosphorylation	WVVIPPGSVLLKPAV EEEECCCCEEEECCC	18.50	22210691

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GLIS2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GLIS2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GLIS2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTNB1_HUMAN	CTNNB1	physical	17289029
RFOX2_HUMAN	RBFOX2	physical	17289029
CYTSA_HUMAN	SPECC1L	physical	17289029
CPSF1_HUMAN	CPSF1	physical	17289029
GPSM2_HUMAN	GPSM2	physical	17289029
U2AF2_HUMAN	U2AF2	physical	17289029
WNK1_HUMAN	WNK1	physical	17289029
SYF1_HUMAN	XAB2	physical	17289029

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
611498	Nephronophthisis 7 (NPHP7)
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GLIS2_HUMAN

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks."; Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.; Cell 127:635-648(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-245, AND MASSSPECTROMETRY.	17081983 [Abstract]