UniProt ID | GL1_ARATH | |
---|---|---|
UniProt AC | P27900 | |
Protein Name | Trichome differentiation protein GL1 {ECO:0000303|PubMed:1934056} | |
Gene Name | GL1 {ECO:0000303|PubMed:1934056} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 228 | |
Subcellular Localization | Nucleus . Detected in trichome nucleus. | |
Protein Description | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity).. | |
Protein Sequence | MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GL1_ARATH !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GL1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GL1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GL1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYB23_ARATH | MYB23 | genetic | 15728674 | |
CPC_ARATH | CPC | genetic | 12356720 | |
GL3_ARATH | GL3 | physical | 11063707 | |
GL3_ARATH | GL3 | physical | 14561633 | |
GL3_ARATH | GL3 | physical | 15584952 | |
BH012_ARATH | ATMYC1 | physical | 22334670 | |
MYB82_ARATH | MYB82 | physical | 24803498 | |
GL1_ARATH | MYB0 | physical | 24803498 | |
RGA_ARATH | RGA1 | physical | 24659329 | |
GAI_ARATH | GAI | physical | 24659329 | |
GL3_ARATH | GL3 | physical | 25926482 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...