dbPTM

GL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	GL1_ARATH
UniProt AC	P27900
Protein Name	Trichome differentiation protein GL1 {ECO:0000303\|PubMed:1934056}
Gene Name	GL1 {ECO:0000303\|PubMed:1934056}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	228
Subcellular Localization	Nucleus . Detected in trichome nucleus.
Protein Description	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in leaves. Together with TTG1 and GL3, promotes trichome formation and endoreplication. Regulates the production of a signal that induces hair (trichome) precursor cells on leaf primordia to differentiate. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes (By similarity)..
Protein Sequence	MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNYLSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAVKTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTNDPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of GL1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of GL1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of GL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of GL1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYB23_ARATH	MYB23	genetic	15728674
CPC_ARATH	CPC	genetic	12356720
GL3_ARATH	GL3	physical	11063707
GL3_ARATH	GL3	physical	14561633
GL3_ARATH	GL3	physical	15584952
BH012_ARATH	ATMYC1	physical	22334670
MYB82_ARATH	MYB82	physical	24803498
GL1_ARATH	MYB0	physical	24803498
RGA_ARATH	RGA1	physical	24659329
GAI_ARATH	GAI	physical	24659329
GL3_ARATH	GL3	physical	25926482

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of GL1_ARATH

Related Literatures of Post-Translational Modification