CPC_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CPC_ARATH
• UniProt AC: O22059
• Protein Name: Transcription factor CPC
• Gene Name: CPC
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 94
• Subcellular Localization: Nucleus . Moves from developing non-hair cells (atrichoblasts) to developing hair cells (trichoblasts).
• Protein Description: Transcription factor. Determines the fate of epidermal cell differentiation. Represses trichome development by lateral inhibition. Together with GL3 or BHLH2, promotes the formation of hair developing cells (H position) in root epidermis, probably by inhibiting non-hair cell formation. Represses the expression of GL2 and WER in H cells. Positively regulates stomatal formation in the hypocotyl. [PubMed: 19513241]
• Protein Sequence: MFRSDKAEKMDKRRRRQSKAKASCSEEVSSIEWEAVKMSEEEEDLISRMYKLVGDRWELIAGRIPGRTPEEIERYWLMKHGVVFANRRRDFFRK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of CPC_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CPC_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CPC_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CPC_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TRY_ARATH	TRY	genetic	12356720
EGL1_ARATH	EGL3	physical	21914815
GL3_ARATH	GL3	physical	21914815
GL3_ARATH	GL3	physical	17644729
GL3_ARATH	GL3	physical	25926482

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.