TRY_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TRY_ARATH
• UniProt AC: Q8GV05
• Protein Name: Transcription factor TRY
• Gene Name: TRY
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 106
• Subcellular Localization: Nucleus . Detected in trichome nucleus.
• Protein Description: Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation..
• Protein Sequence: MDNTDRRRRRKQHKIALHDSEEVSSIEWEFINMTEQEEDLIFRMYRLVGDRWDLIAGRVPGRQPEEIERYWIMRNSEGFADKRRQLHSSSHKHTKPHRPRFSIYPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TRY_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TRY_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TRY_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TRY_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYB23_ARATH	MYB23	genetic	15728674
GL3_ARATH	GL3	physical	14561633
BH012_ARATH	ATMYC1	physical	22334670
GL3_ARATH	GL3	physical	25926482

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.