dbPTM

MYB23_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MYB23_ARATH
UniProt AC	Q96276
Protein Name	Transcription factor MYB23
Gene Name	MYB23
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	219
Subcellular Localization	Nucleus .
Protein Description	Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Regulates the epidermal cell fate specification. Mediates the formation of columellae and accumulation of mucilages on seed coats. Controls the elongation of epidermal cells positively in roots but negatively in stems, leading to the promotion of primary roots elongation and repression of leaves and stems elongation, respectively. Ovoids ectopic root-hair formation, probably by inducing GL2 in roots. Controls trichome initiation and branching..
Protein Sequence	MRMTRDGKEHEYKKGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVNRGNFTDQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGLGDHSTAVKAACGVESPPSMALITTTSSSHQEISGGKNSTLRFDTLVDESKLKPKSKLVHATPTDVEVAATVPNLFDTFWVLEDDFELSSLTMMDFTNGYCL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of MYB23_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MYB23_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MYB23_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MYB23_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MYB23_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MYB23_ARATH

Related Literatures of Post-Translational Modification