GKN1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GKN1_HUMAN
• UniProt AC: Q9NS71
• Protein Name: Gastrokine-1
• Gene Name: GKN1
• Organism: Homo sapiens (Human).
• Sequence Length: 199
• Subcellular Localization: Secreted.
• Protein Description: Has mitogenic activity and may be involved in maintaining the integrity of the gastric mucosal epithelium..
• Protein Sequence: MLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
135	Phosphorylation	PPPKGLMYSVNPNKV CCCCCCEEECCCCCH	17.95	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GKN1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GKN1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GKN1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBR5_HUMAN	UBR5	physical	27590582
LEG1H_HUMAN	C6orf58	physical	28514442
LYZL1_HUMAN	LYZL1	physical	28514442
CYTN_HUMAN	CST1	physical	28514442
PIGR_HUMAN	PIGR	physical	28514442
CYTS_HUMAN	CST4	physical	28514442
ZG16B_HUMAN	ZG16B	physical	28514442
MUC7_HUMAN	MUC7	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.