GBG7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBG7_HUMAN
• UniProt AC: O60262
• Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
• Gene Name: GNG7
• Organism: Homo sapiens (Human).
• Sequence Length: 68
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Plays a role in the regulation of adenylyl cyclase signaling in certain regions of the brain. Plays a role in the formation or stabilzation of a G protein heterotrimer (G(olf) subunit alpha-beta-gamma-7) that is required for adenylyl cyclase activity in the striatum (By similarity)..
• Protein Sequence: MSATNNIAQARKLVEQLRIEAGIERIKVSKAASDLMSYCEQHARNDPLLVGVPASENPFKDKKPCIIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSATNNIAQ ------CCCCCHHHH	43.74	19413330
2	Phosphorylation	------MSATNNIAQ ------CCCCCHHHH	43.74	23532336
4	Phosphorylation	----MSATNNIAQAR ----CCCCCHHHHHH	22.84	29255136
27	Ubiquitination	EAGIERIKVSKAASD HHCCCHHHHCHHHHH	46.83	32015554
30	Ubiquitination	IERIKVSKAASDLMS CCHHHHCHHHHHHHH	51.46	32015554
65	Methylation	PFKDKKPCIIL---- CCCCCCCCEEC----	4.08	-
65	Geranylgeranylation	PFKDKKPCIIL---- CCCCCCCCEEC----	4.08	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBG7_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBG7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBG7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB1_HUMAN	GNB1	physical	8636150
GBB2_HUMAN	GNB2	physical	8636150
GBB3_HUMAN	GNB3	physical	8636150
GBB4_HUMAN	GNB4	physical	8636150
GNB5_HUMAN	GNB5	physical	8636150
GBB1_HUMAN	GNB1	physical	19168127
GBB2_HUMAN	GNB2	physical	19168127
GBB3_HUMAN	GNB3	physical	19168127
GNB5_HUMAN	GNB5	physical	25241761

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.