| UniProt ID | FNG_DROME | |
|---|---|---|
| UniProt AC | Q24342 | |
| Protein Name | Fringe glycosyltransferase | |
| Gene Name | fng | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 412 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . |
|
| Protein Description | Glycosyltransferase involved in the elongation of O-linked ligands to activate Notch signaling. Possesses fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity; extends the O-linked fucose on the Notch EGF repeats. Boundary-specific cell-signaling molecule that is responsible for dorsal-ventral cell interactions during wing development.. | |
| Protein Sequence | MMSLTVLSPPQRFKRILQAMMLAVAVVYMTLLLYQSAYGYPGIQVPHSQVDALASEAVTTHRDQLLQDYVQSSTPTQPGAGAPAASPTTVIIRKDIRSFNFSDIEVSERPTATLLTELARRSRNGELLRDLSQRAVTATPQPPVTELDDIFISVKTTKNYHDTRLALIIKTWFQLARDQTWFFTDTDDHYYQEKTKGHLINTKCSQGHFRKALCCKMSAELDVFLESGKKWFCHFDDDNYVNVPRLVKLLDEYSPSVDWYLGKPSISSPLEIHLDSKNTTTNKKITFWFATGGAGFCLSRALTLKMLPIAGGGKFISIGDKIRFPDDVTMGFIIEHLLKVPLTVVDNFHSHLEPMEFIRQDTFQDQVSFSYAHMKNQWNVIKVDGFDMKTDPKRFYSLHCQLFPYFSFCPPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 218 | Phosphorylation | KALCCKMSAELDVFL HHHHHHHHCEEEEEE | 12.23 | 27794539 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FNG_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FNG_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FNG_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| NOTCH_DROME | N | genetic | 9834035 | |
| NOTCH_DROME | N | genetic | 10683181 | |
| NOTCH_DROME | N | genetic | 12421697 | |
| NOTCH_DROME | N | genetic | 14702038 | |
| CCNE_DROME | CycE | genetic | 12242236 | |
| EGFR_DROME | Egfr | genetic | 16125166 | |
| DL_DROME | Dl | genetic | 14702038 | |
| SERR_DROME | Ser | genetic | 16125166 | |
| PAX6_DROME | ey | genetic | 14702038 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
