FB270_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FB270_ARATH
• UniProt AC: Q9FL82
• Protein Name: F-box protein At5g39250
• Gene Name: At5g39250
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 252
• Protein Sequence: MFSEEVLKNVFPLLEGEDLASCMGVCKQWRDIARDDFYWKCQCAKKWPSVCKRHKPPTETYYKMYQTFSKRRLNRALPPPRLSFENLEFFIDIWSEERLVFSGLIPGVALENGIETLPLGISNVLRTHLGRPDYKMVVPAEPRFTIPLNQSVSVSVLVARNDSDKVARIINRSVFDYIDRSSYRALAFEYLDLSPCYPFISGIRAWISLLFMDVEDMNDDGLLDVFGIQLDFNDVADTKEEVLWLLDMLDWK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
151	Phosphorylation	FTIPLNQSVSVSVLV EEEECCCCEEEEEEE	18.45	28011693
153	Phosphorylation	IPLNQSVSVSVLVAR EECCCCEEEEEEEEC	17.58	28011693
155	Phosphorylation	LNQSVSVSVLVARND CCCCEEEEEEEECCC	11.39	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FB270_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FB270_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FB270_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	23166809
SKP1B_ARATH	ASK2	physical	23166809
ASK3_ARATH	SK3	physical	23166809
ASK9_ARATH	SK9	physical	23166809
ASK11_ARATH	SK11	physical	23166809
ASK12_ARATH	SK12	physical	23166809

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.