UniProt ID | FB270_ARATH | |
---|---|---|
UniProt AC | Q9FL82 | |
Protein Name | F-box protein At5g39250 | |
Gene Name | At5g39250 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 252 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MFSEEVLKNVFPLLEGEDLASCMGVCKQWRDIARDDFYWKCQCAKKWPSVCKRHKPPTETYYKMYQTFSKRRLNRALPPPRLSFENLEFFIDIWSEERLVFSGLIPGVALENGIETLPLGISNVLRTHLGRPDYKMVVPAEPRFTIPLNQSVSVSVLVARNDSDKVARIINRSVFDYIDRSSYRALAFEYLDLSPCYPFISGIRAWISLLFMDVEDMNDDGLLDVFGIQLDFNDVADTKEEVLWLLDMLDWK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
151 | Phosphorylation | FTIPLNQSVSVSVLV EEEECCCCEEEEEEE | 18.45 | 28011693 | |
153 | Phosphorylation | IPLNQSVSVSVLVAR EECCCCEEEEEEEEC | 17.58 | 28011693 | |
155 | Phosphorylation | LNQSVSVSVLVARND CCCCEEEEEEEECCC | 11.39 | 28011693 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FB270_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FB270_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FB270_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SKP1A_ARATH | SKP1 | physical | 23166809 | |
SKP1B_ARATH | ASK2 | physical | 23166809 | |
ASK3_ARATH | SK3 | physical | 23166809 | |
ASK9_ARATH | SK9 | physical | 23166809 | |
ASK11_ARATH | SK11 | physical | 23166809 | |
ASK12_ARATH | SK12 | physical | 23166809 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...