dbPTM

FANCL_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FANCL_MOUSE
UniProt AC	Q9CR14
Protein Name	E3 ubiquitin-protein ligase FANCL
Gene Name	Fancl
Organism	Mus musculus (Mouse).
Sequence Length	375
Subcellular Localization	Cytoplasm . Nucleus . In the nucleus, colocalizes with UBE2W.
Protein Description	Ubiquitin ligase protein that mediates monoubiquitination of FANCD2, a key step in the DNA damage pathway. Also mediates monoubiquitination of FANCI. May stimulate the ubiquitin release from UBE2W. May be required for proper primordial germ cell proliferation in the embryonic stage, whereas it is probably not needed for spermatogonial proliferation after birth..
Protein Sequence	MDEAEASLLRHFPLLLPQNREKTVYEGFISAQGSDFHLRIVLPKDLQLKKARLLCSLQLKNILNEYHQVVQQRMKHSPDLMSFMMELKMILEVALKNKQELCVQPPSCSFCKDLLTEIGAIGWDKLACVESSFSTIKLKADDASGRKHLITVKLKAKYPVEPPDCVVDFPVPFSVSWTPQSSLVDVYSQFLVALETLKVFWDVMDEIDEKTWVLEPEKPPRSATARRIALGKNVSIAIEVDPRHPTMLPEFCFLGADHVTKPLGMKLSGSIHLWDPENSLLQNLKDVLEIDFPARSILEESDFSMDCGICYARHLNGAIPDQVCNNPQCGQPFHEICLYEWLRGLSTSRQSFNVFFGDCPYCSKPITLKMSGRKP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FANCL_MOUSE !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FANCL_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FANCL_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FANCL_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
UBE2W_MOUSE	Ube2w	physical	21229326
GGN_MOUSE	Ggn	physical	12574169
FANCB_HUMAN	FANCB	physical	26496610
TMM33_HUMAN	TMEM33	physical	26496610
FP100_HUMAN	C17orf70	physical	26496610

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FANCL_MOUSE

Related Literatures of Post-Translational Modification