UBE2W_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: UBE2W_MOUSE
• UniProt AC: Q8VDW4
• Protein Name: Ubiquitin-conjugating enzyme E2 W
• Gene Name: Ube2w
• Organism: Mus musculus (Mouse).
• Sequence Length: 151
• Subcellular Localization: Nucleus . In the nucleus, colocalizes with FANCL.
• Protein Description: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini. [PubMed: 21855799]
• Protein Sequence: MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
129	Phosphorylation	KRRPPDNSFYVRTCN HCCCCCCCEEEEECC	25.90	25338131
131	Phosphorylation	RPPDNSFYVRTCNKN CCCCCCEEEEECCCC	6.72	29514104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of UBE2W_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
1	M	ubiquitylation	Autoubiquitinated at Met-1.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of UBE2W_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of UBE2W_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.