UniProt ID | F222A_HUMAN | |
---|---|---|
UniProt AC | Q5U5X8 | |
Protein Name | Protein FAM222A | |
Gene Name | FAM222A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 452 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLACLQRTQNAPGQHLACPSKSLELRKCEAVASAMHSSRYPSPAELDAYAEKVANSPLSIKIFPTNIRVPQHKHLSRTVNGYDTSGQRYSPYPQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAAVQVGIAPYPVPSTLGPLAYPKPPEAPAPPPGLPAAATAASVIPLPGRGLPLPPSNLPSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKPPPPPPQPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPAAAVVVTELGPGAARELAGPPADALSGLPSKSVCNTSVLSSSLQSLEYLINDIRPPCIKEQMLGKGYETVAVPRLLDHQHAHIRLPVYR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | HLACPSKSLELRKCE CCCCCCCCCHHHHHH | 31.26 | 24719451 | |
40 | Phosphorylation | SAMHSSRYPSPAELD HHHHHCCCCCHHHHH | 15.26 | - | |
82 | Phosphorylation | LSRTVNGYDTSGQRY HHCCCCCCCCCCCCC | 15.73 | - | |
89 | Phosphorylation | YDTSGQRYSPYPQHT CCCCCCCCCCCCCCC | 13.20 | - | |
92 | Phosphorylation | SGQRYSPYPQHTAGY CCCCCCCCCCCCCCH | 15.02 | 22817900 | |
99 | Phosphorylation | YPQHTAGYQGLLAIV CCCCCCCHHHHHHHH | 9.28 | 22817900 | |
115 | Phosphorylation | AAVSSSSTAAPAGPA HHHHCCCCCCCCCCH | 28.87 | - | |
124 | Phosphorylation | APAGPAKSVLKSAEG CCCCCHHHHHHHCCC | 34.49 | 21406692 | |
257 | Phosphorylation | LPDCRKGTELGQGAT CCCCCCCCCCCCHHH | 30.95 | 25219547 | |
264 | Phosphorylation | TELGQGATQALTLAG CCCCCHHHHHHHHHH | 22.62 | 25219547 | |
268 | Phosphorylation | QGATQALTLAGAAKP CHHHHHHHHHHCCCC | 19.99 | 25219547 | |
312 | Phosphorylation | GSTVASKSPEACGGR CCCCCCCCCCCCCCC | 26.02 | 24719451 | |
393 | Phosphorylation | DALSGLPSKSVCNTS HHHCCCCCCCCCCHH | 42.48 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of F222A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of F222A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of F222A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MEIS2_HUMAN | MEIS2 | physical | 28514442 | |
MEIS1_HUMAN | MEIS1 | physical | 28514442 | |
MB211_HUMAN | MAB21L1 | physical | 28514442 | |
PBX2_HUMAN | PBX2 | physical | 28514442 | |
PBX3_HUMAN | PBX3 | physical | 28514442 | |
PBX1_HUMAN | PBX1 | physical | 28514442 | |
NLK_HUMAN | NLK | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...