| UniProt ID | ERF69_ARATH | |
|---|---|---|
| UniProt AC | Q8W4I5 | |
| Protein Name | Ethylene-responsive transcription factor ERF069 | |
| Gene Name | ERF069 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 159 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity).. | |
| Protein Sequence | MKRIVRISFTDMEATDSSSSEDESPPSSRRRGKKLVKEIVIDHSDPPEVGKTRFKIRIPASLLAARNTTANKKKFRGVRQRPWGKWAAEIRCGRVKGRPERIWLGTFETAEEAALAYDNAAIQLIGPDAPTNFGRPDVDSAVVKKQDSDASGGASEEVV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of ERF69_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ERF69_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ERF69_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ERF69_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CRF1_ARATH | CRF1 | physical | 21705390 | |
| CRF2_ARATH | CRF2 | physical | 21705390 | |
| CRF3_ARATH | CRF3 | physical | 21705390 | |
| CRF4_ARATH | CRF4 | physical | 21705390 | |
| CRF5_ARATH | CRF5 | physical | 21705390 | |
| CRF6_ARATH | CRF6 | physical | 21705390 | |
| ERF70_ARATH | AT1G71130 | physical | 21705390 | |
| ERF69_ARATH | AT1G22985 | physical | 21705390 | |
| AHP1_ARATH | AHP1 | physical | 21705390 | |
| AHP2_ARATH | AHP2 | physical | 21705390 | |
| AHP3_ARATH | AHP3 | physical | 21705390 | |
| AHP4_ARATH | AHP4 | physical | 21705390 | |
| AHP5_ARATH | AHP5 | physical | 21705390 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
