| UniProt ID | EMX1_HUMAN | |
|---|---|---|
| UniProt AC | Q04741 | |
| Protein Name | Homeobox protein EMX1 | |
| Gene Name | EMX1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 257 | |
| Subcellular Localization | Nucleus . Cytoplasm . Might be shuttling between the nucleus and the cytoplasm. | |
| Protein Description | Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system.. | |
| Protein Sequence | MFQPAAKRGFTIESLVAKDGGTGGGTGGGGAGSHLLAAAASEEPLRPTALNYPHPSAAEAAFVSGFPAAAAAGAGRSLYGGPELVFPEAMNHPALTVHPAHQLGASPLQPPHSFFGAQHRDPLHFYPWVLRNRFFGHRFQASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGAERKQLAGSLSLSETQVKVWFQNRRTKYKRQKLEEEGPESEQKKKGSHHINRWRIATKQANGEDIDVTSND | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 197 | Phosphorylation | KQLAGSLSLSETQVK HHHCCCCCCCHHHHH | 31.39 | 28555341 | |
| 201 | Phosphorylation | GSLSLSETQVKVWFQ CCCCCCHHHHHHHHH | 34.97 | 28555341 | |
| 226 | Phosphorylation | LEEEGPESEQKKKGS HHHHCCHHHHHHHCC | 48.76 | 26437602 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EMX1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EMX1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EMX1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| HXA10_HUMAN | HOXA10 | physical | 20211142 | |
| RPB4_HUMAN | POLR2D | physical | 20211142 | |
| P63_HUMAN | TP63 | physical | 20211142 | |
| TF2AY_HUMAN | GTF2A1L | physical | 20211142 | |
| PRDM4_HUMAN | PRDM4 | physical | 20211142 | |
| ALX4_HUMAN | ALX4 | physical | 20211142 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
