ELL3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ELL3_HUMAN
• UniProt AC: Q9HB65
• Protein Name: RNA polymerase II elongation factor ELL3
• Gene Name: ELL3
• Organism: Homo sapiens (Human).
• Sequence Length: 397
• Subcellular Localization: Nucleus .
• Protein Description: Enhancer-binding elongation factor that specifically binds enhancers in embryonic stem cells (ES cells), marks them, and is required for their future activation during stem cell specification. Does not only bind to enhancer regions of active genes, but also marks the enhancers that are in a poised or inactive state in ES cells and is required for establishing proper RNA polymerase II occupancy at developmentally regulated genes in a cohesin-dependent manner. Probably required for priming developmentally regulated genes for later recruitment of the super elongation complex (SEC), for transcriptional activation during differentiation. Required for recruitment of P-TEFb within SEC during differentiation. Probably preloaded on germ cell chromatin, suggesting that it may prime gene activation by marking enhancers as early as in the germ cells. Promoting epithelial-mesenchymal transition (EMT) (By similarity). Elongation factor component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III. [PubMed: 22195968]
• Protein Sequence: MEELQEPLRGQLRLCFTQAARTSLLLLRLNDAALRALQECQRQQVRPVIAFQGHRGYLRLPGPGWSCLFSFIVSQCCQEGAGGSLDLVCQRFLRSGPNSLHCLGSLRERLIIWAAMDSIPAPSSVQGHNLTEDARHPESWQNTGGYSEGDAVSQPQMALEEVSVSDPLASNQGQSLPGSSREHMAQWEVRSQTHVPNREPVQALPSSASRKRLDKKRSVPVATVELEEKRFRTLPLVPSPLQGLTNQDLQEGEDWEQEDEDMDPRLEHSSSVQEDSESPSPEDIPDYLLQYRAIHSAEQQHAYEQDFETDYAEYRILHARVGTASQRFIELGAEIKRVRRGTPEYKVLEDKIIQEYKKFRKQYPSYREEKRRCEYLHQKLSHIKGLILEFEEKNRGS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
105	Phosphorylation	NSLHCLGSLRERLII CHHHHHHHHHHHHHH	16.00	24719451
207	Phosphorylation	PVQALPSSASRKRLD CCCCCCCCHHHHHHH	28.46	28555341
209	Phosphorylation	QALPSSASRKRLDKK CCCCCCHHHHHHHCC	40.04	28555341
218	Phosphorylation	KRLDKKRSVPVATVE HHHHCCCCCCCEEEE	39.39	28674151
229	Ubiquitination	ATVELEEKRFRTLPL EEEEEEHHHHCCCCC	47.68	-
239	Phosphorylation	RTLPLVPSPLQGLTN CCCCCCCCCCCCCCC	30.66	25954137
245	Phosphorylation	PSPLQGLTNQDLQEG CCCCCCCCCCCHHCC	37.34	28348404
269	Phosphorylation	MDPRLEHSSSVQEDS CCHHHCCCCCCCCCC	18.22	26714015
270	Phosphorylation	DPRLEHSSSVQEDSE CHHHCCCCCCCCCCC	36.11	26714015
271	Phosphorylation	PRLEHSSSVQEDSES HHHCCCCCCCCCCCC	30.73	26714015
276	Phosphorylation	SSSVQEDSESPSPED CCCCCCCCCCCCCCC	38.94	26714015
278	Phosphorylation	SVQEDSESPSPEDIP CCCCCCCCCCCCCCC	34.33	25849741
280	Phosphorylation	QEDSESPSPEDIPDY CCCCCCCCCCCCCHH	50.64	26714015
287	Phosphorylation	SPEDIPDYLLQYRAI CCCCCCHHHHHHHHH	12.17	26714015
351	Ubiquitination	EYKVLEDKIIQEYKK CHHHHHHHHHHHHHH	32.12	29967540
363	Phosphorylation	YKKFRKQYPSYREEK HHHHHHHCCCHHHHH	9.36	28509920
365	Phosphorylation	KFRKQYPSYREEKRR HHHHHCCCHHHHHHH	31.71	28509920
366	Phosphorylation	FRKQYPSYREEKRRC HHHHCCCHHHHHHHH	19.96	28509920

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ELL3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ELL3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ELL3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
FRIH_HUMAN	FTH1	physical	16169070
ICE2_HUMAN	ICE2	physical	26186194
AFF1_HUMAN	AFF1	physical	26186194
ICE1_HUMAN	ICE1	physical	26186194
AF9_HUMAN	MLLT3	physical	26186194
ENL_HUMAN	MLLT1	physical	26186194
EAF2_HUMAN	EAF2	physical	26186194
ADDG_HUMAN	ADD3	physical	26186194
CCNT2_HUMAN	CCNT2	physical	26186194
CCNT1_HUMAN	CCNT1	physical	26186194
CDK14_HUMAN	CDK14	physical	26186194
ELL_HUMAN	ELL	physical	26186194
ENL_HUMAN	MLLT1	physical	28514442
ICE1_HUMAN	ICE1	physical	28514442
AFF1_HUMAN	AFF1	physical	28514442
ICE2_HUMAN	ICE2	physical	28514442
AF9_HUMAN	MLLT3	physical	28514442
CCNT1_HUMAN	CCNT1	physical	28514442
CDK14_HUMAN	CDK14	physical	28514442
CCNT2_HUMAN	CCNT2	physical	28514442
ELL_HUMAN	ELL	physical	28514442
EAF2_HUMAN	EAF2	physical	28514442
ADDG_HUMAN	ADD3	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.