UniProt ID | DPOD3_SCHPO | |
---|---|---|
UniProt AC | P30261 | |
Protein Name | DNA polymerase delta subunit 3 | |
Gene Name | cdc27 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 372 | |
Subcellular Localization | Nucleus. | |
Protein Description | ||
Protein Sequence | MEEWRNFLDIKVINESSLVTVDNLSLQLDISSEKAQEYLNMFYQGNDFLYPIYLIHGQPIDDEINLEIDEESQPISNFPVLQYILCDKSSLQEKQSRLKSGYKTVIFALSSAPLSDFDELLPAVYEIREKDVLYKKEDADKYGFIFNENSVPRVLKKAPSTHSPQLSVPSKTSTIDKTDTRSTEKTKGKDIFSNARNQKGNSSRKNKKAPLENHKEKEPLLPKEEKLSEQAKRERDDLKNIMQLEDESVSTTSVHDSEDDNLDSNNFQLEIGTEAKSAAPDEPQEIIKSVSGGKRRGKRKVKKYATTKDEEGFLVTKEEEVWESFSEDENISTGTSNVVRNKPTTVNIATKKKNTAQSKPQQKSIMSFFGKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
160 | Phosphorylation | RVLKKAPSTHSPQLS HHHHCCCCCCCCCCC | 43.54 | 24763107 | |
161 | Phosphorylation | VLKKAPSTHSPQLSV HHHCCCCCCCCCCCC | 25.88 | 21712547 | |
163 | Phosphorylation | KKAPSTHSPQLSVPS HCCCCCCCCCCCCCC | 17.90 | 28889911 | |
167 | Phosphorylation | STHSPQLSVPSKTST CCCCCCCCCCCCCCC | 27.08 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPOD3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPOD3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPOD3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DPOD4_SCHPO | cdm1 | genetic | 9799358 | |
CID1_SCHPO | cid1 | genetic | 10757807 | |
RFC2_SCHPO | rfc2 | genetic | 9862966 | |
DPOD2_SCHPO | cdc1 | genetic | 8887553 | |
PCNA_SCHPO | pcn1 | physical | 12124382 | |
PCNA_SCHPO | pcn1 | physical | 10698951 | |
DPOD2_SCHPO | cdc1 | physical | 15579205 | |
PCNA_SCHPO | pcn1 | physical | 15579205 | |
DPOA_SCHPO | pol1 | physical | 15579205 | |
DPOD4_SCHPO | cdm1 | physical | 9326594 | |
DPOD2_SCHPO | cdc1 | physical | 9326594 | |
DPOD4_SCHPO | cdm1 | physical | 12124382 | |
DPOD2_SCHPO | cdc1 | physical | 12124382 | |
CDS1_SCHPO | cds1 | genetic | 16738311 | |
CHK1_SCHPO | chk1 | genetic | 16738311 | |
RAD1_SCHPO | rad1 | genetic | 16738311 | |
PCNA_SCHPO | pcn1 | physical | 22308326 | |
DPOD2_SCHPO | cdc1 | genetic | 23211746 | |
AST1_SCHPO | ast1 | genetic | 23211746 | |
FEN1_SCHPO | rad2 | genetic | 23211746 | |
FEN1_SCHPO | rad2 | genetic | 9891047 | |
CDS1_SCHPO | cds1 | genetic | 9891047 | |
RAD26_SCHPO | rad26 | genetic | 9891047 | |
HUS2_SCHPO | rqh1 | genetic | 9891047 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...