dbPTM

DOPP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DOPP1_HUMAN
UniProt AC	Q86YN1
Protein Name	Dolichyldiphosphatase 1
Gene Name	DOLPP1
Organism	Homo sapiens (Human).
Sequence Length	238
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate (By similarity)..
Protein Sequence	MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
235	Phosphorylation	NRQRKLGTKLQ---- HHHHHHCCCCC----	38.73	29496963

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DOPP1_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DOPP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DOPP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HPHL1_HUMAN	HEPHL1	physical	26186194
SBP1_HUMAN	SELENBP1	physical	26186194
LYG2_HUMAN	LYG2	physical	26186194
ASSY_HUMAN	ASS1	physical	26186194
LRC15_HUMAN	LRRC15	physical	26186194
PKP3_HUMAN	PKP3	physical	26186194
SBP1_HUMAN	SELENBP1	physical	28514442
HPHL1_HUMAN	HEPHL1	physical	28514442
LRC15_HUMAN	LRRC15	physical	28514442
LYG2_HUMAN	LYG2	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DOPP1_HUMAN

Related Literatures of Post-Translational Modification