UniProt ID | DOPP1_HUMAN | |
---|---|---|
UniProt AC | Q86YN1 | |
Protein Name | Dolichyldiphosphatase 1 | |
Gene Name | DOLPP1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 238 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. |
|
Protein Description | Required for efficient N-glycosylation. Necessary for maintaining optimal levels of dolichol-linked oligosaccharides. Hydrolyzes dolichyl pyrophosphate at a very high rate and dolichyl monophosphate at a much lower rate. Does not act on phosphatidate (By similarity).. | |
Protein Sequence | MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNEGVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLSLGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWFEYTVTRAEARNRQRKLGTKLQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
235 | Phosphorylation | NRQRKLGTKLQ---- HHHHHHCCCCC---- | 38.73 | 29496963 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOPP1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOPP1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOPP1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HPHL1_HUMAN | HEPHL1 | physical | 26186194 | |
SBP1_HUMAN | SELENBP1 | physical | 26186194 | |
LYG2_HUMAN | LYG2 | physical | 26186194 | |
ASSY_HUMAN | ASS1 | physical | 26186194 | |
LRC15_HUMAN | LRRC15 | physical | 26186194 | |
PKP3_HUMAN | PKP3 | physical | 26186194 | |
SBP1_HUMAN | SELENBP1 | physical | 28514442 | |
HPHL1_HUMAN | HEPHL1 | physical | 28514442 | |
LRC15_HUMAN | LRRC15 | physical | 28514442 | |
LYG2_HUMAN | LYG2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...