LYG2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LYG2_HUMAN
• UniProt AC: Q86SG7
• Protein Name: Lysozyme g-like protein 2
• Gene Name: LYG2
• Organism: Homo sapiens (Human).
• Sequence Length: 212
• Subcellular Localization: Secreted .
• Protein Description: May act as a potent antibacterial protein that may play a role in the innate immunity..
• Protein Sequence: MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MLSSVVFWGL -----CCHHHHHHHH	21.56	24043423
4	Phosphorylation	----MLSSVVFWGLI ----CCHHHHHHHHH	20.52	24043423
181	Phosphorylation	GGLSAFKSGIEAIAT HHHHHHHHCCCEECC	38.25	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LYG2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LYG2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LYG2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NID2_HUMAN	NID2	physical	28514442
SPT20_HUMAN	SPATA20	physical	28514442
VP33B_HUMAN	VPS33B	physical	28514442
SPE39_HUMAN	VIPAS39	physical	28514442
BIRC2_HUMAN	BIRC2	physical	28514442
ZER1_HUMAN	ZER1	physical	28514442
CO4A2_HUMAN	COL4A2	physical	28514442
2ABD_HUMAN	PPP2R2D	physical	28514442
TRAF2_HUMAN	TRAF2	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.