| UniProt ID | DCP1_SCHPO | |
|---|---|---|
| UniProt AC | Q9P805 | |
| Protein Name | mRNA-decapping enzyme subunit 1 | |
| Gene Name | dcp1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 127 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Component of the decapping complex necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Decapping is the major pathway of mRNA degradation in yeast. It occurs through deadenylation, decapping and subsequent 5' to 3' exonucleolytic decay of the transcript body.. | |
| Protein Sequence | MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of DCP1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCP1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCP1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCP1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| DCP2_SCHPO | dcp2 | physical | 15671491 | |
| DCP2_SCHPO | dcp2 | physical | 16341225 | |
| DCP2_SCHPO | dcp2 | physical | 18280239 | |
| DCP2_SCHPO | dcp2 | physical | 22085934 | |
| EDC3_SCHPO | edc3 | physical | 22085934 | |
| XRN1_SCHPO | exo2 | physical | 27354705 | |
| RAN1_SCHPO | ran1 | physical | 27354705 | |
| DHH1_SCHPO | ste13 | physical | 27354705 | |
| DCP2_SCHPO | dcp2 | physical | 27354705 | |
| YAQ9_SCHPO | SPAC18G6.09c | physical | 27354705 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
