DHH1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DHH1_SCHPO
• UniProt AC: Q09181
• Protein Name: Putative ATP-dependent RNA helicase ste13
• Gene Name: ste13
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 485
• Subcellular Localization: Cytoplasm, P-body. Is concentrated in several cytoplasmic foci called P bodies (or cytoplasmic processing bodies) which represent sites of mRNA decapping and 5' to 3' exonucleotidic decay..
• Protein Description: ATP-dependent RNA helicase involved in mRNA turnover, and more specifically in mRNA decapping. Is involved in G1/S DNA-damage checkpoint recovery, probably through the regulation of the translational status of a subset of mRNAs. May also have a role in translation and mRNA nuclear export (By similarity)..
• Protein Sequence: MAESLIQKLENANLNDRESFKGQMKAQPVDMRPKTEDVTKTRGTEFEDYYLKRELLMGIFEAGFERPSPIQEESIPIALSGRDILARAKNGTGKTAAFVIPSLEKVDTKKSKIQTLILVPTRELALQTSQVCKTLGKHMNVKVMVTTGGTTLRDDIIRLNDTVHIVVGTPGRVLDLAGKGVADFSECTTFVMDEADKLLSPEFTPIIEQLLSYFPKNRQISLYSATFPLIVKNFMDKHLNKPYEINLMDELTLRGVTQYYAFVDESQKVHCLNTLFSKLQINQSIIFCNSTNRVELLAKKITELGYSCFYSHAKMLQSHRNRVFHNFRNGVCRNLVCSDLLTRGIDIQAVNVVINFDFPKNAETYLHRIGRSGRFGHRGLAISFISWADRFNLYRIENELGTEIQPIPPSIDPSLYVFPNGDYQIPRPLTASADQVLAAQQAKGQEGYHNRPNNNRGGHPRGGGNRGGYRQSNRQPRYRGQQKAD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	ANLNDRESFKGQMKA CCCCCHHHHCCCCCC	32.90	24763107
95	Phosphorylation	AKNGTGKTAAFVIPS HCCCCCCEEEEEECC	25.27	25720772
111	Phosphorylation	EKVDTKKSKIQTLIL HHCCCCCCHHCEEEE	36.23	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DHH1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DHH1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DHH1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAS3_SCHPO	tas3	physical	26771498
YN8E_SCHPO	SPBP35G2.14	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.