| UniProt ID | YAQ9_SCHPO | |
|---|---|---|
| UniProt AC | Q10108 | |
| Protein Name | Uncharacterized protein C18G6.09c | |
| Gene Name | SPAC18G6.09c | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 312 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MQKDIGRRFQRNKKKINSKPGGAMVASSDVEFSLDGMSIMPQRDGNLQIPNFVKPKSTFATSNIGESNGKRNGDKVRGNRRSKSGHSSYAGSRISGGNSNSHLPSGVASAPAGLGIDKVAVGEVDSHLKSVSSYVSNSSGADRSFSSNSSSDTNSILYAGPTFTHSPAASNLPIPTFLHSPVSEKAEWQPPTGSVNSNMPFQFHQSSSVPSTPSEVAMGHNFCPMSRNDPSLQSIQQTNGFYSGHNSPHTNYSASTPSFNHFNAAGHPTGNITPTLNSPNNGIHCHSTSALDLLFHRDREQRLFRMLRQGSA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 89 | Phosphorylation | SKSGHSSYAGSRISG CCCCCCCCCCCCCCC | 20.28 | 27738172 | |
| 95 | Phosphorylation | SYAGSRISGGNSNSH CCCCCCCCCCCCCCC | 39.27 | 25720772 | |
| 99 | Phosphorylation | SRISGGNSNSHLPSG CCCCCCCCCCCCCCC | 42.88 | 27738172 | |
| 101 | Phosphorylation | ISGGNSNSHLPSGVA CCCCCCCCCCCCCCC | 26.65 | 25720772 | |
| 109 | Phosphorylation | HLPSGVASAPAGLGI CCCCCCCCCCCCCCC | 32.17 | 28889911 | |
| 133 | Phosphorylation | SHLKSVSSYVSNSSG HHHHHHHHHHHCCCC | 27.65 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YAQ9_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YAQ9_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YAQ9_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of YAQ9_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...