YAQ9_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YAQ9_SCHPO
• UniProt AC: Q10108
• Protein Name: Uncharacterized protein C18G6.09c
• Gene Name: SPAC18G6.09c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 312
• Protein Sequence: MQKDIGRRFQRNKKKINSKPGGAMVASSDVEFSLDGMSIMPQRDGNLQIPNFVKPKSTFATSNIGESNGKRNGDKVRGNRRSKSGHSSYAGSRISGGNSNSHLPSGVASAPAGLGIDKVAVGEVDSHLKSVSSYVSNSSGADRSFSSNSSSDTNSILYAGPTFTHSPAASNLPIPTFLHSPVSEKAEWQPPTGSVNSNMPFQFHQSSSVPSTPSEVAMGHNFCPMSRNDPSLQSIQQTNGFYSGHNSPHTNYSASTPSFNHFNAAGHPTGNITPTLNSPNNGIHCHSTSALDLLFHRDREQRLFRMLRQGSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
89	Phosphorylation	SKSGHSSYAGSRISG CCCCCCCCCCCCCCC	20.28	27738172
95	Phosphorylation	SYAGSRISGGNSNSH CCCCCCCCCCCCCCC	39.27	25720772
99	Phosphorylation	SRISGGNSNSHLPSG CCCCCCCCCCCCCCC	42.88	27738172
101	Phosphorylation	ISGGNSNSHLPSGVA CCCCCCCCCCCCCCC	26.65	25720772
109	Phosphorylation	HLPSGVASAPAGLGI CCCCCCCCCCCCCCC	32.17	28889911
133	Phosphorylation	SHLKSVSSYVSNSSG HHHHHHHHHHHCCCC	27.65	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YAQ9_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YAQ9_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YAQ9_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YAQ9_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.